PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g39720.1
Common NameLOC4339092, Os05g0474800, OSNPB_050474800, P0486C01.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 573aa    MW: 59652.3 Da    PI: 5.5018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g39720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.7e-32219276260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK++kgse+prsYY+Ct++gCp+kkkve+s  d++v+ei+Y+g H h+k
  LOC_Os05g39720.1 219 DDGYNWRKYGQKQMKGSENPRSYYKCTFPGCPTKKKVEQSP-DGQVTEIVYKGAHSHPK 276
                       8****************************************.***************85 PP

2WRKY106.51.4e-33391449159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d ++v++tYeg+Hnh+
  LOC_Os05g39720.1 391 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASNDLRAVITTYEGKHNHD 449
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.6E-28214277IPR003657WRKY domain
SuperFamilySSF1182901.7E-24216277IPR003657WRKY domain
SMARTSM007744.6E-35218276IPR003657WRKY domain
PfamPF031068.0E-25219275IPR003657WRKY domain
PROSITE profilePS5081123.112219277IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-37376451IPR003657WRKY domain
SuperFamilySSF1182901.7E-29383451IPR003657WRKY domain
PROSITE profilePS5081138.526386451IPR003657WRKY domain
SMARTSM007741.4E-38391450IPR003657WRKY domain
PfamPF031065.4E-26392449IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MTAAPGSLPL VNSRPVSLSL AASRSSFSSL LSGGAGSSLN LMTPPSSLPP SSPSSYFGGV  60
SSSGFLDSPI LLTPSLFPSP TTTGALFSWI TTATATAAIA PESQVQGGVK DEQQQYSDFT  120
FLPTASTAPA TTMAGATATT SNSFMQDSML MAPLGGDPYN GEQQQPWSYQ EPTMDADTRP  180
AEFTSSAAAG DVAGNGSYSQ VAAPAAAGGF RQQSRRSSDD GYNWRKYGQK QMKGSENPRS  240
YYKCTFPGCP TKKKVEQSPD GQVTEIVYKG AHSHPKPPQN GRGRGGSGYA LHGGAASDAY  300
SSADALSGTP VATPENSSAS FGDDEAVNGV SSSLRVASSV GGGEDLDDDE PDSKRWRRDG  360
GDGEGVSLVA GNRTVREPRV VVQTMSDIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTTA  420
GCPVRKHVER ASNDLRAVIT TYEGKHNHDV PAARGSAAAA LYRATPPPQA SNAGMMPTTA  480
QPSSYLQGGG GVLPAGGYGA SYGGAPTTTQ PANGGGFAAL SGRFDDDATG ASYSYTSQQQ  540
QQPNDAVYYA SRAKDEPRDD GIMSFFEQPL LF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36219452878Probable WRKY transcription factor 4
2lex_A1e-36219452878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.501080.0callus| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379894900.0
Expression AtlasQ65WW1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g39720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g39720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981840.0DQ298184.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 70 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637836.10.0PREDICTED: probable WRKY transcription factor 33
TrEMBLQ65WW10.0Q65WW1_ORYSJ; Os05g0474800 protein
TrEMBLQ6IEL10.0Q6IEL1_ORYSI; WRKY transcription factor 70
STRINGBGIOSGA017876-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g39720.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-85WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Ryu HS, et al.
    A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response.
    Plant Cell Rep., 2006. 25(8): p. 836-47
    [PMID:16528562]