PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g38820.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 144aa    MW: 15147 Da    PI: 5.2724
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g38820.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.67.7e-5836131196
             NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre+
  LOC_Os05g38820.4  36 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREV 128
                       69******************************************************************************************9 PP

             NF-YB  94 ege 96 
                        ++
  LOC_Os05g38820.4 129 RTD 131
                       987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-5335130IPR009072Histone-fold
SuperFamilySSF471132.02E-3939130IPR009072Histone-fold
PfamPF008081.4E-2842106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.5E-237088No hitNo description
PROSITE patternPS0068507389IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.5E-2389107No hitNo description
PRINTSPR006157.5E-23108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MADGPGSPGG GGGSHESGSP RGGGGGGGGG GGGGGVREQD RFLPIANISR IMKKAIPANG  60
KIAKDAKETV QECVSEFISF ITSEASDKCQ REKRKTINGD DLLWAMATLG FEDYIEPLKV  120
YLQKYREVRT DVDVWNWGDS LLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-5035127193NF-YB
4awl_B2e-5035127294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-5035127294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.278390.0callus| flower| leaf| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329860200.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g38820.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g38820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1008110.0AK100811.1 Oryza sativa Japonica Group cDNA clone:J023121O11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253500.12e-68PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
SwissprotP252091e-65NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLA0A0P0WNF05e-89A0A0P0WNF0_ORYSJ; Os05g0463800 protein
STRINGBGIOSGA017902-PA2e-87(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-62nuclear factor Y, subunit B8