PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g38460.1
Common NameOs05g0459000, OSNPB_050459000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 589aa    MW: 64784 Da    PI: 8.3763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g38460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.81.2e-085895147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g WT+eEde+l +av  + g++Wk+I           qc +rwqk+
  LOC_Os05g38460.1 58 KGGWTPEEDEKLRKAVDIYNGKNWKKI----E-----VQCLHRWQKV 95
                      688***********************5....3.....4577777775 PP

2Myb_DNA-binding59.29.3e-19102148148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd+ +++ vk++G++ W+ Iar ++ gR +kqc++rw+++l
  LOC_Os05g38460.1 102 KGPWTQEEDDVIINMVKKHGPKKWSVIARSLN-GRIGKQCRERWHNHL 148
                       79******************************.*************97 PP

3Myb_DNA-binding51.32.6e-16154197146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       + +WT eE+  l++a+ ++G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os05g38460.1 154 KEAWTVEEERVLARAHCMYGNK-WAEIAKLLP-GRTDNSIKNHWNS 197
                       579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.0825396IPR017930Myb domain
SMARTSM007171.6E-45798IPR001005SANT/Myb domain
PfamPF002497.4E-65895IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-959106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-1660106IPR009057Homeodomain-like
PROSITE profilePS5129430.66197152IPR017930Myb domain
SuperFamilySSF466892.02E-3199195IPR009057Homeodomain-like
SMARTSM007174.1E-17101150IPR001005SANT/Myb domain
PfamPF002496.8E-17102148IPR001005SANT/Myb domain
CDDcd001671.14E-15104148No hitNo description
Gene3DG3DSA:1.10.10.603.5E-25107150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-22151203IPR009057Homeodomain-like
SMARTSM007171.3E-14153201IPR001005SANT/Myb domain
PROSITE profilePS5129421.856153203IPR017930Myb domain
PfamPF002497.0E-15154197IPR001005SANT/Myb domain
CDDcd001671.04E-11156199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MGAMPAVKVE EEEEERNPVA SSPSVSEGSA HAAALASPTA ADSIFGRRRK SGPVRRAKGG  60
WTPEEDEKLR KAVDIYNGKN WKKIEVQCLH RWQKVLDPEL IKGPWTQEED DVIINMVKKH  120
GPKKWSVIAR SLNGRIGKQC RERWHNHLDP QIRKEAWTVE EERVLARAHC MYGNKWAEIA  180
KLLPGRTDNS IKNHWNSSLR KKIDDYNTRD ILPVHPPVVG DGLKQLPKRP PADNHFDLNK  240
EPIICSRDRL GVVHSDPTSH QRASNLKDFK GCADYLSLGQ PVTSCEASAA DDSAFDLATQ  300
GMRMDSVHDK GTGNNFVCGK VQGINFLGDK GLKINQISDK MGCSRQAKRE GEAAINGGGS  360
SLQSEAHSVG SLCYQIPKME DIAPAQSPVF TANYVPEHSR NVMHSPNGYT TPPTHGKGSD  420
QLSVESILRS AAEKFHGTPS ILRRRKRDKP TPAEDNDLKI GRLSSDDFHT PIGKCTTDSP  480
QSFKTAALLS LGPMDEQGSL DVSPPYRLRS KRLAVLKTVQ NHLDFSSDEM SICDTTMKSA  540
CGNSDCANAS SGVSSIQGKK LDEHMIGLET LTMNFAHTTK LDATQPNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-64572035159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-64572035159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442449RRRKRDKP
2443448RRKRDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.547840.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154642960.0
Expression AtlasQ0DHL1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g38460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g38460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067560.0AK106756.1 Oryza sativa Japonica Group cDNA clone:002-115-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637435.10.0PREDICTED: uncharacterized protein LOC4339005
TrEMBLQ0DHL10.0Q0DHL1_ORYSJ; Os05g0459000 protein
STRINGLOC_Os05g38460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.27e-96myb domain protein 3r-5