PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g38120.1
Common NameLOC4338977, OJ1651_D06.6, Os05g0455200, OSNPB_050455200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 581aa    MW: 62116.3 Da    PI: 8.2236
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g38120.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.21.8e-103583951954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  LOC_Os05g38120.1 358 FEHflHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVR 395
                       554459******************************88 PP

2BELL91.77.2e-30225294372
              BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +e q +k++L+sl+e V+krY+qy++qlq+v+ssFe+vagl +a+p++s+Al+++S+hF+ Lk  i +q+
  LOC_Os05g38120.1 225 AEQQWRKTRLISLMEDVCKRYRQYYQQLQAVVSSFETVAGLSNAAPFASMALRTMSKHFKYLKGIILNQL 294
                       58899*************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.3E-34153292IPR006563POX domain
PfamPF075264.9E-36158290IPR006563POX domain
PROSITE profilePS5007112.455336399IPR001356Homeobox domain
CDDcd000864.19E-14339400No hitNo description
SMARTSM003891.4E-11339403IPR001356Homeobox domain
SuperFamilySSF466894.28E-17341406IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-29342403IPR009057Homeodomain-like
PfamPF059205.1E-19356395IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MSSAAGGGGG YGGGGGEHQH QQQQHHLLLG QAAGQLYHVP QHSRREKLRF PPDHPAESPP  60
PPPPGSWPLP PAFYSYASSS SSYSPHSPTL AHAQLVAHGM PPGAATSGGA QIPSQNFALS  120
LSSASSNPPP TPRRQFGGGG GGGGAAGPYG PFTGYAAVLG RSRFLGPAQK LLEEICDVGG  180
RPAQLDRGSD EGLLDVDAMD AAGSVDHEMD GSDRAVADAV TVSGAEQQWR KTRLISLMED  240
VCKRYRQYYQ QLQAVVSSFE TVAGLSNAAP FASMALRTMS KHFKYLKGII LNQLRNTGKG  300
ATKDGLGKED TTNFGLMGGG AGLLRGNNVN SFSQPHNIWR PQRGLPERAV SVLRAWLFEH  360
FLHPYPTDSD KQMLAKQTGL TRNQVSNWFI NARVRLWKPM VEEIHNLEMR QLQKNPSLDK  420
NQLSMQHTQH SSDSSGKPCD PSNSLQGQSS SMTRNHSISA SRHIEDGLSQ MPHDISGQVS  480
FAYNGLAAHH SIAMAHHHQP DLIGTGGAAN AGGVSLTLGL HQNNNRAYIA EPLPAALPLN  540
LAHRFGLEDV SDAYVMSSFG GQDRHFTKEI GGHLLHDFVG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-17345403563Homeobox protein Meis2
4xrm_B2e-17345403563Homeobox protein Meis2
4xrs_A1e-17345402158Homeobox protein Meis1
4xrs_B1e-17345402158Homeobox protein Meis1
5bng_A2e-17345403159Homeobox protein Meis2
5bng_B2e-17345403159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.273080.0callus| flower| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329861250.0
Expression AtlasQ60EM7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g38120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g38120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009160.0AK100916.1 Oryza sativa Japonica Group cDNA clone:J023133E06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637721.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLQ60EM70.0Q60EM7_ORYSJ; Os05g0455200 protein
STRINGLOC_Os05g38120.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.17e-68TALE family protein