PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g37080.1
Common NameB1110B01.14, LOC4338926, NAC12, Os05g0442700, OSJNBa0020H14.9, OSNPB_050442700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 275aa    MW: 30459.4 Da    PI: 5.2477
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g37080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.22.5e-4341371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                       lppG+rF Pt+eelv++yL++k++g +   ++e+vi+ +d+++++Pw+Lp+    + +++ + w++F++r++++a+g r++r+t sgyWka g
  LOC_Os05g37080.1   4 LPPGYRFYPTEEELVCFYLRHKLDGGRrvPDIERVIPVADVCSLDPWQLPEahqgAWTGDGEPWFYFCPRQEREARGGRPSRTTPSGYWKAAG 96 
                       79***********************9988788889**************95344433447789****************************** PP

               NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   v+s++g+ +g+kkt+vfy+grap g kt+W m+eyr+
  LOC_Os05g37080.1  97 TPGWVYSSDGRPIGTKKTMVFYRGRAPAGAKTKWKMNEYRA 137
                       ***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-503169IPR003441NAC domain
PROSITE profilePS5100547.94170IPR003441NAC domain
PfamPF023656.9E-245136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGELPPGYRF YPTEEELVCF YLRHKLDGGR RVPDIERVIP VADVCSLDPW QLPEAHQGAW  60
TGDGEPWFYF CPRQEREARG GRPSRTTPSG YWKAAGTPGW VYSSDGRPIG TKKTMVFYRG  120
RAPAGAKTKW KMNEYRAFEE DDDNAAAAAP AQNHYLQTRS DFSLCRLYTR SGCPRQFDRR  180
PPSSSVAGGG GENRAAPSST AAAFANEDAA ESSGKSQKRK RSAPDDSLDS TSSSDDNGGC  240
DGSMLQQQQQ RQRGTDEELV ECSMTDWADL LDWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-32417017165NO APICAL MERISTEM PROTEIN
1ut4_B1e-32417017165NO APICAL MERISTEM PROTEIN
1ut7_A1e-32417017165NO APICAL MERISTEM PROTEIN
1ut7_B1e-32417017165NO APICAL MERISTEM PROTEIN
3swm_A2e-32417020168NAC domain-containing protein 19
3swm_B2e-32417020168NAC domain-containing protein 19
3swm_C2e-32417020168NAC domain-containing protein 19
3swm_D2e-32417020168NAC domain-containing protein 19
3swp_A2e-32417020168NAC domain-containing protein 19
3swp_B2e-32417020168NAC domain-containing protein 19
3swp_C2e-32417020168NAC domain-containing protein 19
3swp_D2e-32417020168NAC domain-containing protein 19
4dul_A1e-32417017165NAC domain-containing protein 19
4dul_B1e-32417017165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.517830.0root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329737210.0
Expression AtlasQ6F2M8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g37080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g37080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1854420.0JN185442.1 Oryza sativa Japonica Group NAC transcription factor 12 (NAC12) mRNA, complete cds.
GenBankAK0637030.0AK063703.1 Oryza sativa Japonica Group cDNA clone:001-119-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638341.10.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR37e-65NAC90_ARATH; NAC domain-containing protein 90
TrEMBLQ6F2M80.0Q6F2M8_ORYSJ; 'putative no apical meristem (NAM) protein, PF02365
STRINGLOC_Os05g37080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22781136
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-64NAC domain containing protein 90