PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g37060.1
Common NameB1110B01.12, LOC4338925, Os05g0442400, OsJ_18706, OSJNBa0020H14.7, OSNPB_050442400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 183aa    MW: 20381.6 Da    PI: 7.8409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g37060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271e-082773347
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      +W++ Ed+ +  a   ++ +   +W+++a++++ gR++ ++ +++q +
  LOC_Os05g37060.1 27 PWSKAEDKVFESALVAFPEHthnRWALVASRLP-GRSAHEVWEHYQVL 73
                      8***************9999999**********.************86 PP

2Myb_DNA-binding45.32.1e-14114158347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  LOC_Os05g37060.1 114 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 158
                       8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.1472078IPR017930Myb domain
SMARTSM007172.7E-72476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-72671IPR009057Homeodomain-like
SuperFamilySSF466895.31E-122681IPR009057Homeodomain-like
PfamPF002492.7E-72773IPR001005SANT/Myb domain
CDDcd001671.02E-62774No hitNo description
PROSITE profilePS5129419.617107163IPR017930Myb domain
SuperFamilySSF466895.18E-18109163IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-16111162IPR006447Myb domain, plants
SMARTSM007172.8E-10111161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-11113154IPR009057Homeodomain-like
PfamPF002498.1E-11114157IPR001005SANT/Myb domain
CDDcd001672.60E-11114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MAFYLGSMGG SPSSWGVAEV PVPSSRPWSK AEDKVFESAL VAFPEHTHNR WALVASRLPG  60
RSAHEVWEHY QVLVDDVDLI ERGMVASPGC WDDDNNSAGH GRGSGGDERR RGVPWTEEEH  120
RLFLEGLEKY GRGDWRNISR WSVKTRTPTQ VASHAQKFFI RQANASSRGD SKRKSIHDIT  180
AP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-142489772RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.549340.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329923430.0
Expression AtlasQ6F2M6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g37060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g37060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071340.0AK107134.1 Oryza sativa Japonica Group cDNA clone:002-124-C08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.11e-132PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9ZZV11e-132A0A0D9ZZV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PN451e-132A0A0E0PN45_ORYRU; Uncharacterized protein
TrEMBLA2Y5551e-132A2Y555_ORYSI; Putative uncharacterized protein
TrEMBLQ6F2M61e-132Q6F2M6_ORYSJ; Os05g0442400 protein
STRINGBGIOSGA017964-PA1e-132(Oryza sativa Indica Group)
STRINGLOC_Os05g37060.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-42MYB family protein