PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g36900.1
Common NameLOC4338919, Os05g0440000, OSNPB_050440000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 328aa    MW: 34160.1 Da    PI: 6.3366
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g36900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.51.2e-373892660
            zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       +cprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  LOC_Os05g36900.1 38 PNCPRCESPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 92
                      68***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-302892IPR003851Zinc finger, Dof-type
PfamPF027011.0E-313892IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7233892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLSSHCESML AYAAAAGRRA VVVDHHQRRY RPNVEVAPNC PRCESPNTKF CYYNNYSLSQ  60
PRYFCKGCRR YWTKGGSLRN VPVGGGCRKN RRGKAVRAMV GETMTARGGG GGGAAAFSHR  120
FHGPVRPDMI LEGMAGSTAA SAGLGEQPGV AAPDEKPAAA DGSTIDLALL YAKFLNHHQP  180
TMAEQGGGAA VPESVDTSSG SSSDRTTSPA AAQPAAAAAY GPGQDGLVGE PISTEEHGAA  240
AMARCAQALG ELNFSVDQIS CYTSLGLPTT DGGDLILPST LDQHAKYEPF DSLPEDALSL  300
HDIISGDDDV WCNALGCQGL EAALCRP*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154641320.0
Expression AtlasQ0DHU3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g36900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g36900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474620.0AC147462.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1110B01, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638935.10.0PREDICTED: uncharacterized protein LOC4338919
TrEMBLA0A0E0PN280.0A0A0E0PN28_ORYRU; Uncharacterized protein
TrEMBLQ0DHU30.0Q0DHU3_ORYSJ; Os05g0440000 protein
STRINGLOC_Os05g36900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-36Dof family protein