PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g36160.2
Common NameOJ1058_F05.8, Os05g0437700, OSJNBb0042J17.2, OSNPB_050437700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 248aa    MW: 25159.1 Da    PI: 6.0935
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g36160.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14186237354
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                       + +r++r++kNRe+A rsR+RK+a+i+eLe  v+eLe+e  +L  e ee ++
  LOC_Os05g36160.2 186 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQ 237
                       689**************************************99977666444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-8184245IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875186234IPR004827Basic-leucine zipper domain
PfamPF001702.3E-12186236IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.96E-11188237No hitNo description
CDDcd147071.64E-17188234No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-13189235No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MASSRVMAAA AASSSSSPPP PPPAAAAAGG AADLARFRST SSGIGSMNMD DILRNIYGEA  60
APPPGAAGSA PAPPPAGEAA GAPVAEVAAR RTAEEVWKEI SSSGGLSAPA PAPAAGAAGR  120
GGGPEMTLED FLAREDDPRA TAVEGNMVVG FPNVTEGVGT AGGGRGGGGG GRGRKRTLMD  180
PADRAAMQRQ KRMIKNRESA ARSRERKQAY IAELEAQVAE LEEEHAQLLR EQEEKNQKRL  240
KEVSLIV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170GGRGGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.379250.0callus| leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379902790.0
Expression AtlasQ75HX9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g36160.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g36160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1206560.0AK120656.1 Oryza sativa Japonica Group cDNA clone:J013158B06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639395.11e-168PREDICTED: G-box-binding factor 4
TrEMBLQ75HX91e-171Q75HX9_ORYSJ; Os05g0437700 protein
STRINGLOC_Os05g36160.11e-167(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.15e-12bZIP family protein