PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g35500.1
Common NameLOC9266213, Os05g0429900, OSJNBb0048I21.9, OSNPB_050429900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 261aa    MW: 28351.2 Da    PI: 8.8946
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g35500.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
  LOC_Os05g35500.1 14 KGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding55.61.2e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T +Edel+++++ +lG++ W++Ia  ++ gRt++++k++w+++
  LOC_Os05g35500.1  67 RGNFTDDEDELIIRLHSLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.221961IPR017930Myb domain
SMARTSM007176.7E-141363IPR001005SANT/Myb domain
SuperFamilySSF466892.82E-2913108IPR009057Homeodomain-like
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001678.90E-121661No hitNo description
PROSITE profilePS5129428.162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-2865116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002499.9E-1667111IPR001005SANT/Myb domain
CDDcd001678.51E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDEDELIIR LHSLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPQTHRPLL SGGDGIAASN KAAPPPPHPI SVPAKAAAAA IFAVAKPPPP PRPVDSSDDG  180
CRSSSGTTST GEPRCPDLNL ELSVGPTPSS PPAETPTSAR PVCLCYHLGF RGGEACSCQA  240
DSKGPHEFRY FRPLEQGQYI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101750.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977241500.0
Expression AtlasQ5TKI8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g35500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g35500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372460.0EU837246.1 Oryza sativa Japonica Group clone KCS051A09 myb transcription factor mRNA, complete cds.
GenBankAK1040530.0AK104053.1 Oryza sativa Japonica Group cDNA clone:001-023-G03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.10.0PREDICTED: myb-related protein 308
SwissprotP813935e-93MYB08_ANTMA; Myb-related protein 308
TrEMBLA2Y4Y50.0A2Y4Y5_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0PMV10.0A0A0E0PMV1_ORYRU; Uncharacterized protein
TrEMBLQ5TKI80.0Q5TKI8_ORYSJ; Myb transcription factor
STRINGBGIOSGA018002-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g35500.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.13e-86myb domain protein 6