PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g35170.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 303aa    MW: 34242.2 Da    PI: 6.1711
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g35170.5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.52.7e-4961331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtd elv++yLk+k+ gkk  + ++i++v++yk+ PwdLp + ++++++ ew+fF++rdkky++g+r+nr+t +gyWk++gkd++
  LOC_Os05g35170.5   6 LPPGFRFHPTDVELVSYYLKRKIMGKKPLI-QAISDVELYKFAPWDLPaQsCLQSRDLEWFFFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRT 97 
                       79*************************777.88**************95347778888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +++ vg kktL+f++g+apkg++tdWvm ey++
  LOC_Os05g35170.5  98 IEL-NSRIVGSKKTLIFHEGKAPKGNRTDWVMYEYKM 133
                       ***.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-583156IPR003441NAC domain
PROSITE profilePS5100556.2186156IPR003441NAC domain
PfamPF023655.1E-267132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAQTCLPPGF RFHPTDVELV SYYLKRKIMG KKPLIQAISD VELYKFAPWD LPAQSCLQSR  60
DLEWFFFCPR DKKYPNGSRT NRSTPNGYWK TSGKDRTIEL NSRIVGSKKT LIFHEGKAPK  120
GNRTDWVMYE YKMEDNQLVS AGFSKDDFVL CKIFKKSGLG PRIGEQYGAP FNEEEWEHAD  180
AEMFPLLPNV ETSVFPLLPS SEVVNSTDDT RVQPSVAARA IEELPVQHLP HVCAGNGSTY  240
QNITVTGESA LMELPSQHSV ESIGDEGLLN WVCQMVMDFL RPMLVLLNNS PHTLEFLTVK  300
IM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-52215711169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.120200.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329847490.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g35170.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g35170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469980.0EU846998.1 Oryza sativa Japonica Group clone KCS104B01 NAM-like protein mRNA, complete cds.
GenBankAB3621600.0AB362160.1 Oryza sativa Japonica Group mRNA for transcription factor, complete cds.
GenBankAK0995400.0AK099540.1 Oryza sativa Japonica Group cDNA clone:J013032G17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639254.10.0PREDICTED: NAC domain-containing protein 78 isoform X1
RefseqXP_015639255.10.0PREDICTED: NAC domain-containing protein 78 isoform X2
SwissprotQ84K005e-75NAC78_ARATH; NAC domain-containing protein 78
SwissprotQ9FY828e-76NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A0E0HEQ90.0A0A0E0HEQ9_ORYNI; Uncharacterized protein
TrEMBLB8AYH20.0B8AYH2_ORYSI; Putative uncharacterized protein
TrEMBLI1PVT80.0I1PVT8_ORYGL; Uncharacterized protein
TrEMBLQ60EC00.0Q60EC0_ORYSJ; NAM-like protein
STRINGBGIOSGA018023-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g35170.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0148600.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-81NAC domain containing protein 103