PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g35170.1
Common NameLOC4338852, Os05g0426200, OsJ_18610, OSJNBa0044P19.7, OSNPB_050426200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 450aa    MW: 49739.6 Da    PI: 4.5984
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g35170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.46.1e-4961331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtd elv++yLk+k+ gkk  + ++i++v++yk+ PwdLp + ++++++ ew+fF++rdkky++g+r+nr+t +gyWk++gkd++
  LOC_Os05g35170.1   6 LPPGFRFHPTDVELVSYYLKRKIMGKKPLI-QAISDVELYKFAPWDLPaQsCLQSRDLEWFFFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRT 97 
                       79*************************777.88**************95347778888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +++ vg kktL+f++g+apkg++tdWvm ey++
  LOC_Os05g35170.1  98 IEL-NSRIVGSKKTLIFHEGKAPKGNRTDWVMYEYKM 133
                       ***.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-583156IPR003441NAC domain
PROSITE profilePS5100556.2186156IPR003441NAC domain
PfamPF023651.2E-257132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MAQTCLPPGF RFHPTDVELV SYYLKRKIMG KKPLIQAISD VELYKFAPWD LPAQSCLQSR  60
DLEWFFFCPR DKKYPNGSRT NRSTPNGYWK TSGKDRTIEL NSRIVGSKKT LIFHEGKAPK  120
GNRTDWVMYE YKMEDNQLVS AGFSKDDFVL CKIFKKSGLG PRIGEQYGAP FNEEEWEHAD  180
AEMFPLLPNV ETSVFPLLPS SEVVNSTDDT RVQPSVAARA IEELPVQHLP HVCAGNGSTY  240
QNITVTGESA LMELPSQHSV ESIGDEVVSV DNCSNVVNNA DSPVIEGLVL EELSRFLTDS  300
PHHGNPVGEH SGLPPMSEAE AHAFEVSTND LYNEIAGLAE LGVPNGDGFS PSNAGVTEQQ  360
PTYFGVPNSE NYVNMDDIFA PDTRLSYAYP LPNNQFWHYP MDQFTYSTTL SAAFPSGDSR  420
PTMRIVDDLP AAANNGGFAS KPSMQFPLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50215711169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.120200.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329847490.0
Expression AtlasQ60EC0-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g35170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g35170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469980.0EU846998.1 Oryza sativa Japonica Group clone KCS104B01 NAM-like protein mRNA, complete cds.
GenBankAB3621600.0AB362160.1 Oryza sativa Japonica Group mRNA for transcription factor, complete cds.
GenBankAK0995400.0AK099540.1 Oryza sativa Japonica Group cDNA clone:J013032G17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639254.10.0PREDICTED: NAC domain-containing protein 78 isoform X1
TrEMBLA0A0E0HEQ90.0A0A0E0HEQ9_ORYNI; Uncharacterized protein
TrEMBLI1PVT80.0I1PVT8_ORYGL; Uncharacterized protein
TrEMBLQ60EC00.0Q60EC0_ORYSJ; NAM-like protein
STRINGLOC_Os05g35170.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0148600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP47313664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.14e-80NAC domain containing protein 103
Publications ? help Back to Top
  1. Ogo Y, et al.
    A novel NAC transcription factor, IDEF2, that recognizes the iron deficiency-responsive element 2 regulates the genes involved in iron homeostasis in plants.
    J. Biol. Chem., 2008. 283(19): p. 13407-17
    [PMID:18308732]