PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34940.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 194aa    MW: 22433.2 Da    PI: 10.0441
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34940.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.1e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtfskRr+gilKKA E+ vLCdaev v+ifss gkl +y++
  LOC_Os05g34940.3  9 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCT 59
                      79***********************************************96 PP

2K-box69.69.6e-2471159193
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yq++sgk l+++k++sl+ e++++kke++n+q e+Rh++GedL+sL+ keL  +e++L+++  + R+k +++++++ ++ ++ e+e    +k+
  LOC_Os05g34940.3  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDE----HKM 159
                       89999999***********************************************************9777776666666655555....444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002651.42E-39280No hitNo description
SuperFamilySSF554552.62E-32295IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-1682163IPR002487Transcription factor, K-box
PROSITE profilePS5129711.72684172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGILK KAREIGVLCD AEVGVVIFSS AGKLSDYCTP  60
KTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRHMKG EDLNSLQPKE  120
LIAIEEALNN GQANLRDKMM DHWRMHKRNE KMLEDEHKML AFRVVISFRV TCFSIELSLE  180
KFLVFSFLFL KTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18186178Myocyte-specific enhancer factor 2B
1tqe_Q2e-18186178Myocyte-specific enhancer factor 2B
1tqe_R2e-18186178Myocyte-specific enhancer factor 2B
1tqe_S2e-18186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.22140.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329854420.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34940.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankRICOSMAA0.0L37527.1 Oryza sativa MADS box protein (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640709.11e-118PREDICTED: MADS-box transcription factor 4 isoform X1
SwissprotQ407031e-118MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLB8AYK11e-118B8AYK1_ORYSI; Putative uncharacterized protein
TrEMBLB9FPP61e-118B9FPP6_ORYSJ; Uncharacterized protein
TrEMBLI1PVS61e-118I1PVS6_ORYGL; Uncharacterized protein
STRINGBGIOSGA019900-PA1e-118(Oryza sativa Indica Group)
STRINGORGLA05G0147400.11e-118(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-65MIKC_MADS family protein