PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34940.1
Common NameMADS4, OJ1212_B02.5, Os05g0423400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24908.5 Da    PI: 9.0978
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34940.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.82.6e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++nrqvtfskRr+gilKKA E+ vLCdaev v+ifss gkl +y++
  LOC_Os05g34940.1  9 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCT 59
                      79***********************************************96 PP

2K-box67.73.9e-2376172197
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yq++sgk l+++k++sl+ e++++kke++n+q e+Rh++GedL+sL+ keL  +e++L+++  + R+k +++++++ ++ ++ e+e++    +
  LOC_Os05g34940.1  76 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDEHKMLAFR 168
                       89999999************************************************************9988888888888888887777666 PP

             K-box  94 Lrkk 97 
                        +++
  LOC_Os05g34940.1 169 VHQQ 172
                       6665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-302100IPR002100Transcription factor, MADS-box
CDDcd002652.34E-40285No hitNo description
PRINTSPR004049.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014866.0E-1687169IPR002487Transcription factor, K-box
PROSITE profilePS5129712.6989175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGILK KAREIGVLCD AEVGVVIFSS AGKLSDYCTP  60
KTTSVFPPLS RILEKYQTNS GKILWDEKHK SLSAEIDRVK KENDNMQIEL RHMKGEDLNS  120
LQPKELIAIE EALNNGQANL RDKMMDHWRM HKRNEKMLED EHKMLAFRVH QQEVELSGGI  180
RELELGYHHD DRDFAASMPF TFRVQPSHPN LQQEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-17176169Myocyte-specific enhancer factor 2B
1tqe_Q4e-17176169Myocyte-specific enhancer factor 2B
1tqe_R4e-17176169Myocyte-specific enhancer factor 2B
1tqe_S4e-17176169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.22140.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329854420.0
Expression AtlasQ40703-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in lodicules, at intermediate levels in stamens, and weakly in carpels. Expressed in pollen. {ECO:0000269|PubMed:10394955, ECO:0000269|PubMed:12905025, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002330.0AK100233.1 Oryza sativa Japonica Group cDNA clone:J023051B10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640709.11e-154PREDICTED: MADS-box transcription factor 4 isoform X1
SwissprotQ407031e-163MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLB8AYK11e-154B8AYK1_ORYSI; Putative uncharacterized protein
TrEMBLB9FPP61e-154B9FPP6_ORYSJ; Uncharacterized protein
STRINGLOC_Os05g34940.11e-161(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53021222
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.18e-72MIKC_MADS family protein
Publications ? help Back to Top
  1. Moon YH,Jung JY,Kang HG,An G
    Identification of a rice APETALA3 homologue by yeast two-hybrid screening.
    Plant Mol. Biol., 1999. 40(1): p. 167-77
    [PMID:10394955]
  2. Lee S, et al.
    Alteration of floral organ identity in rice through ectopic expression of OsMADS16.
    Planta, 2003. 217(6): p. 904-11
    [PMID:12905025]
  3. Kang HG,Jeon JS,Lee S,An G
    Identification of class B and class C floral organ identity genes from rice plants.
    Plant Mol. Biol., 1998. 38(6): p. 1021-9
    [PMID:9869408]