PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34830.3
Common NameLOC4338832, OSJNBb0092E21.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 258aa    MW: 27338.8 Da    PI: 9.5722
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34830.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.48.7e-3057754128
               NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   + v +kk Lvfy g+apkg kt+W+mheyrl
  LOC_Os05g34830.3   5 GEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--PRPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 77 
                       579************************************99..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.3381103IPR003441NAC domain
SuperFamilySSF1019416.28E-363103IPR003441NAC domain
PfamPF023653.3E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG SGYWKATGAD KPVGTPRPVA IKKALVFYAG  60
KAPKGDKTNW IMHEYRLADV DRSARKKNTL RLDDWVLCRI YNKKGGVEKP SGGGGGERSN  120
MMSHGETASA GSPPEQKPAV LPPPPPPYAA AAPFSELAAF YDVRPSDSVP RAHGADSSCS  180
EHVLTTSASS GGVVERPEVQ SQPKIAEWER TFAGAAAPAG AVSTAGPILG QLDPAAAVAG  240
GGDPLLQDIL MYWGKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-49210966171NO APICAL MERISTEM PROTEIN
1ut4_B3e-49210966171NO APICAL MERISTEM PROTEIN
1ut7_A3e-49210966171NO APICAL MERISTEM PROTEIN
1ut7_B3e-49210966171NO APICAL MERISTEM PROTEIN
3swm_A4e-49210969174NAC domain-containing protein 19
3swm_B4e-49210969174NAC domain-containing protein 19
3swm_C4e-49210969174NAC domain-containing protein 19
3swm_D4e-49210969174NAC domain-containing protein 19
3swp_A4e-49210969174NAC domain-containing protein 19
3swp_B4e-49210969174NAC domain-containing protein 19
3swp_C4e-49210969174NAC domain-containing protein 19
3swp_D4e-49210969174NAC domain-containing protein 19
4dul_A3e-49210966171NAC domain-containing protein 19
4dul_B3e-49210966171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.519261e-76callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154845141e-76
Expression AtlasQ6L4Y5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34830.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1077460.0AK107746.1 Oryza sativa Japonica Group cDNA clone:002-132-H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637488.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-112NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLQ6L4Y50.0Q6L4Y5_ORYSJ; Putative no apical meristem (NAM) protein
STRINGLOC_Os05g34830.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-70NAC family protein