PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34830.1
Common NameLOC4338832, OSJNBb0092E21.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 323aa    MW: 34595.2 Da    PI: 8.5611
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34830.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.8e-51181421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL+++++g ++ +  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v 
  LOC_Os05g34830.1  18 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEVDLYKFDPWHLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVG 109
                       79**************************99.88***************7666789*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   + v +kk Lvfy g+apkg kt+W+mheyrl
  LOC_Os05g34830.1 110 T--PRPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 142
                       9..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-6213168IPR003441NAC domain
PROSITE profilePS5100559.40518168IPR003441NAC domain
PfamPF023653.6E-2619142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MSGGGEGAAA AERQELQLPP GFRFHPTDEE LVMHYLCRRC AGLPIAVPII AEVDLYKFDP  60
WHLPRMALYG EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPVGT PRPVAIKKAL  120
VFYAGKAPKG DKTNWIMHEY RLADVDRSAR KKNTLRLDDW VLCRIYNKKG GVEKPSGGGG  180
GERSNMMSHG ETASAGSPPE QKPAVLPPPP PPYAAAAPFS ELAAFYDVRP SDSVPRAHGA  240
DSSCSEHVLT TSASSGGVVE RPEVQSQPKI AEWERTFAGA AAPAGAVSTA GPILGQLDPA  300
AAVAGGGDPL LQDILMYWGK PF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-791517412174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6L4Y5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1077460.0AK107746.1 Oryza sativa Japonica Group cDNA clone:002-132-H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637488.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-154NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLQ6L4Y50.0Q6L4Y5_ORYSJ; Putative no apical meristem (NAM) protein
STRINGLOC_Os05g34830.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-105NAC family protein