PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34600.1
Common NameP0426G01.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 418aa    MW: 44660.6 Da    PI: 6.7218
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1584e-49421672128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  
  LOC_Os05g34600.1  42 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRG 133
                       79***************************.89***************7777899*************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  LOC_Os05g34600.1 134 ENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 167
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5741190IPR003441NAC domain
PROSITE profilePS5100554.84941190IPR003441NAC domain
PfamPF023651.7E-2443167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MSRDDVDDVT AGAAGSGEEA AADQEEAAAA VAGDSHENDL VMPGFRFHPT EEELIEFYLR  60
RKVEGRRFNV ELITFLDLYR FDPWELPAMA VIGEKEWFFY VPRDRKYRNG DRPNRVTASG  120
YWKATGADRM IRGENSRPIG LKKTLVFYSG KAPKGVRSSW IMNEYRLPPP AADADLFYKS  180
EISLCRVYKR SGIDDGHGHH QRPAGNVQAS SSSAAARPPE QHSGNNTAAG LPACRHRPSP  240
SSSSTTTAQQ HTSFHQLLQG ECSAAAAAPP PPPSLPASAT TRNSNASQLL MPPPPPRPPC  300
AAAYTSAAAA PTESAAVLAA ASTYSLLAAA GSSSTHIDEL STLLAGHSHG GAYGNNHIVA  360
GSHHHFPLPP SQLMPQLGTL PISPPLAAVS DKLWDWSSVP DTSTARDYDS SGFSDPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-564319119166NO APICAL MERISTEM PROTEIN
1ut4_B9e-564319119166NO APICAL MERISTEM PROTEIN
1ut7_A9e-564319119166NO APICAL MERISTEM PROTEIN
1ut7_B9e-564319119166NO APICAL MERISTEM PROTEIN
4dul_A9e-564319119166NAC domain-containing protein 19
4dul_B9e-564319119166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.272160.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154639360.0
Expression AtlasQ60DW6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376230.0AC137623.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0426G01, complete sequence.
GenBankAC1349330.0AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637953.10.0PREDICTED: NAC domain-containing protein 48-like
TrEMBLA0A0E0HEK30.0A0A0E0HEK3_ORYNI; Uncharacterized protein
TrEMBLQ0DI410.0Q0DI41_ORYSJ; Os05g0418800 protein
TrEMBLQ60DW60.0Q60DW6_ORYSJ; Putative no apical meristem (NAM) protein
STRINGLOC_Os05g34600.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-95NAC domain containing protein 35