PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34450.1
Common NameLOC4338805, Os05g0417000, OSJNBa0084P24.15, OSNPB_050417000, P0579A05.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 280aa    MW: 28044.3 Da    PI: 8.1341
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601407.8e-4439137199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+++
  LOC_Os05g34450.1  39 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVGVISVLQHQLRQLQQD 131
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l++++ 
  LOC_Os05g34450.1 132 LSRARF 137
                       *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.86138139IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-4439135IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MAASSSASSL PLSSGSVITV SSSPAVGASS GGGGGTGSPC AACKFLRRKC QPDCVFAPYF  60
PPDNPQKFVH VHRVFGASNV TKLLNELHPY QREDAVNSLA YEADMRLRDP VYGCVGVISV  120
LQHQLRQLQQ DLSRARFELS KYQAAVAVSS SNGQAAAAAA MVDHFIGSAV QPNCTQNFIS  180
GGGVAAAAIG IGGGAGGGFV NDHHQFSAVQ MLARSYDGES AVARLGGAVN VSGGGGYEFG  240
YSSAMGGAGG PMSGLGPLGG GTFLKPGTAG GGDRPTAAQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.822900.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154639180.0
Expression AtlasQ6AT73-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376170.0AC137617.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0084P24, complete sequence.
GenBankAC1349330.0AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640070.10.0PREDICTED: LOB domain-containing protein 6
RefseqXP_015640071.10.0PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG31e-110LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLQ6AT730.0Q6AT73_ORYSJ; Os05g0417000 protein
STRINGLOC_Os05g34450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-54LBD family protein