PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34310.1
Common NameLOC4338800, OJ1123_C08.8, Os05g0415400, OsJ_18554, OSJNBa0084P24.1, OSNPB_050415400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 311aa    MW: 33889.2 Da    PI: 4.6038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1462e-45101381128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lp GfrFhPtdeelv +yL+++++g ++++  +i++v+iy+++Pw+Lp+++  +e+ewyfF+ rd++y+++ r++r+++sg+Wkatg+dk+v 
  LOC_Os05g34310.1  10 LPTGFRFHPTDEELVINYLQRRATGLSCPI-PIIADVEIYNFNPWELPSMALFGEHEWYFFTLRDHRYPNSVRPSRSAASGFWKATGTDKPVQ 101
                       699***************************.88***************76667999************************************9 PP

               NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++  +++ v +kk Lvfy gr p  +kt+W+mheyrl
  LOC_Os05g34310.1 102 VAnmQSTPVAMKKALVFYVGRPPMETKTTWIMHEYRL 138
                       98667777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-563173IPR003441NAC domain
PROSITE profilePS5100552.41910173IPR003441NAC domain
PfamPF023655.5E-2411138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAMQLSLPVL PTGFRFHPTD EELVINYLQR RATGLSCPIP IIADVEIYNF NPWELPSMAL  60
FGEHEWYFFT LRDHRYPNSV RPSRSAASGF WKATGTDKPV QVANMQSTPV AMKKALVFYV  120
GRPPMETKTT WIMHEYRLTN TGGSTASHPS LSSSTAHPSV KLDEWVLCKI FNKSPEPDNT  180
APPSNVVSRL QCSPPLPPPA APPGNYPPLP VGATNDGGVF AGAGDMLFTI QEHQEGTPSM  240
LPPIPNLEPP AATIGNSSLN GTAAAAAAAD GHGRLEEEDT SAYTFTDQEM EQMLMDLMDQ  300
DFFGNDQPQE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5811734165NO APICAL MERISTEM PROTEIN
1ut4_B1e-5811734165NO APICAL MERISTEM PROTEIN
1ut7_A1e-5811734165NO APICAL MERISTEM PROTEIN
1ut7_B1e-5811734165NO APICAL MERISTEM PROTEIN
3ulx_A1e-581017615171Stress-induced transcription factor NAC1
4dul_A1e-5811734165NAC domain-containing protein 19
4dul_B1e-5811734165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.500160.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329925390.0
Expression AtlasQ6AT85-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469990.0EU846999.1 Oryza sativa Japonica Group clone KCS021f05 NAM protein mRNA, complete cds.
GenBankAK1073300.0AK107330.1 Oryza sativa Japonica Group cDNA clone:002-126-F03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638459.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY422e-69NAC25_ARATH; NAC transcription factor 25
TrEMBLQ6AT850.0Q6AT85_ORYSJ; Os05g0415400 protein
STRINGLOC_Os05g34310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP162071212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-65NAC domain containing protein 25