PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34110.1
Common NameLOC4338783, Os05g0412000, OsJ_18538, P0017D10.1, P0668F02.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 332aa    MW: 32561.2 Da    PI: 7.0726
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34110.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.52e-30110163155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  LOC_Os05g34110.1 110 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 163
                       59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.63E-20107167IPR009057Homeodomain-like
PROSITE profilePS5129411.059107166IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30109168IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-24111163IPR006447Myb domain, plants
PfamPF002491.3E-7113162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MREEEEPSWF ARWEEQLPAP DELMPLSQSL ITPDLAVAFD IPTHGGGGGG GVGGGVVGGD  60
GVGGGGGGGG GGGGGVGAGE MNGGASSAAG SSGGGGGGGG GDEPARTLKR PRLVWTPQLH  120
KRFVDAVAHL GIKNAVPKTI MQLMSVDGLT RENVASHLQK YRLYLKRMQG VGNGGGGGGG  180
GGAGAGGSHS SGSGTDAATE HLFATGPVPF LPPGRAPAGG DPYPPFAPMG GHHHHPPQIG  240
HFHHHPAARP LGHYGSGPGA GFDHGFLSRA VAGGGPPVGP PGMHHRMVGP AAGMAMMAPS  300
PFAEELELGS RGGGGGGGRR ELTLFPTTGD H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-21109168463ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310318RGGGGGGGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1004940.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6AU85
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1307290.0AC130729.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0668F02, complete sequence.
GenBankAC1306070.0AC130607.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0017D10, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640251.10.0PREDICTED: transcription factor PCL1-like
TrEMBLA2Y4N10.0A2Y4N1_ORYSI; Putative uncharacterized protein
TrEMBLQ6AU850.0Q6AU85_ORYSJ; Os05g0412000 protein
STRINGBGIOSGA018058-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g34110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-52G2-like family protein