PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g34050.1
Common NameLOC4338781, Os05g0411300, OsJ_18536, OSNPB_050411300, P0668F02.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 647aa    MW: 68810 Da    PI: 7.2879
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g34050.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.4e-13170231162
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++    e a+l+++
  LOC_Os05g34050.1 170 EEDERRAARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSRISFVVAENATLRQQ 231
                       677899**********************************9999***999888888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-15170234IPR004827Basic-leucine zipper domain
PfamPF001707.4E-11172232IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.174172232IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-15174233No hitNo description
SuperFamilySSF579591.38E-11174232No hitNo description
CDDcd147041.78E-18179226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MAEPALLDPT AAFDLRLYPA HLFDHELPLA GGGGGDDDDD LPLDGLEFDL PGDFSVEDFL  60
LRSPERDDSG EGSAAGSGPT ASPSSSPTTS ASNSAVANGS GGEVKHEESD EGRSGGGDPK  120
WSLKRKQASP GPSSDAAKCR RSGDGDVSPS ASASRTAVDS DEGGTVCEEE EDERRAARLM  180
RNRESAQLSR QRKKRYVEEL EEKVKSMHSV INDLNSRISF VVAENATLRQ QLSGGSVNCP  240
PPGVYPPAPI PGMHFPWMPG YAMRPPGSHV PLVPIPRLKP QQPVPSSKVV KKPESKKTVE  300
NKSKSKTKTK KVASVSLLGL LLIMLVFGAF IPGFNHNFGM CGQSDNAMFR NFGQSHARVL  360
SVSSQDKSSL NNSDMIGVDV GKMTGNTDGP GKKHQPAHNS SEILPALLYV PRNGKHVKIN  420
GNLIIHSVLA SEKAVAHKAS KDDSDQSARD HKETSVAIAR YLSLPGKDVN RQETSSADGP  480
LPQWFREGME GPILNSGMCS EVFQFDISTA SSNPGGIIPA SPVVNSSSVN ATEKIPAHSA  540
AYHGKLKNRR VMYNEAIPLT GKTANNTEPF NRTSESSSKL PDSKPASSVV VSVLADPREA  600
GNGDGDPRVS PKPLSKIFVV VLVDGVRYVT YSCTLPFKSS SPHLVN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.55350.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166322360.0
Expression AtlasQ6AU90-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g34050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g34050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0731420.0AK073142.1 Oryza sativa Japonica Group cDNA clone:J033024D10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640085.10.0PREDICTED: bZIP transcription factor 17
TrEMBLQ6AU900.0Q6AU90_ORYSJ; Os05g0411300 protein
STRINGLOC_Os05g34050.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21711628
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-77bZIP family protein