PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g33810.1
Common NameLOC4338766, Os05g0408200, OSJNBb0014K18.5, P0040B10.14, SPL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 843aa    MW: 92018.4 Da    PI: 6.1924
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g33810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.35.7e-35171245276
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                       Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  LOC_Os05g33810.1 171 CQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 245
                       ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-27165232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.487168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-33169248IPR004333Transcription factor, SBP-box
PfamPF031106.9E-27171245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MDAPGGGGGG GGGGGGVDAG EPVWDWGNLL DFAVHDDDSL VLPWGDDSIG IEADPAEAAL  60
LPPAPSPQPA EAEAEAAGPA SLPSSMQAEG SKRRVRKRDP RLVCPNYLAG RVPCACPEID  120
EMAAALEVED VATELLAGAR KKPKGAGRGS GAAVGGSGGG ASRGTPAEMK CQVPGCEADI  180
RELKGYHRRH RVCLRCAHAA AVMLDGVQKR YCQQCGKFHI LLDFDEDKRS CRRKLERHNK  240
RRRRKPDSKG ILEKDIDDQL DFSADGSGDG ELREENIDVT TSETLETVLS NKVLDRETPV  300
GSDDVLSSPT CAQPSLQIDQ SKSLVTFAAS VEACLGTKQE NTKLTNSPVH DTKSTYSSSC  360
PTGRVSFKLY DWNPAEFPRR LRHQIFEWLS SMPVELEGYI RPGCTILTVF VAMPQHMWDK  420
LSEDTGNLVK SLVNAPNSLL LGKGAFFIHV NNMIFQVLKD GATLTSTRLE VQSPRIHYVH  480
PSWFEAGKPI DLILCGSSLD QPKFRSLVSF DGLYLKHDCR RILSHETFDC IGSGEHILDS  540
QHEIFRINIT TSKLDTHGPA FVEVENMFGL SNFVPILVGS KHLCSELEQI HDALCGSSDI  600
SSDPCELRGL RQTAMLGFLI DIGWLIRKPS IDEFQNLLSL ANIQRWICMM KFLIQNDFIN  660
VLEIIVNSLD NIIGSELLSN LEKGRLENHV TEFLGYVSEA RNIVDNRPKY DKQRQVDTRW  720
AGDYAPNQPK LGISVPLAES TGTSGEHDLH STNAASGEEE NMPLVTKALP HRQCCHPETS  780
ARWLNAASIG AFPGGAMRMR LATTVVIGAV VCFAACVVLF HPHRVGVLAA PVKRYLSRNY  840
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-37170250585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227245KRSCRRKLERHNKRRRRKP
2231243RRKLERHNKRRRR
3238245NKRRRRKP
4239244KRRRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.194070.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329852660.0
Expression AtlasQ6I576-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g33810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g33810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000570.0AK100057.1 Oryza sativa Japonica Group cDNA clone:J013158B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640052.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A0E0PME10.0A0A0E0PME1_ORYRU; Uncharacterized protein
STRINGLOC_Os05g33810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP48281320
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-144squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]