PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g32890.1
Common NameOs05g0395700, OsJ_18451, OSJNBa0014C03.15, OSNPB_050395700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 369aa    MW: 40359.1 Da    PI: 8.2228
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g32890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like45.91.2e-14182224144
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtle 44 
                       k+r rW +eLHerFv++v qL G +kAtP +il l++ ++Lt++
  LOC_Os05g32890.1 182 KKRFRWPKELHERFVSVVLQL-GVDKATPNQILPLLNREDLTRD 224
                       68*******************.********************97 PP

2Response_reg43.51.7e-156515326109
                       EEEESSHHHHHHHHHHHH.....ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
      Response_reg  26 vaeaddgeealellkekd.....pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                       v+e++  ++a + ++e++     +D++l+ +  p  +dG++ll+   + +++lp++v++a +++ ++l++++ Ga d+l+Kp   eel +
  LOC_Os05g32890.1  65 VDEVTPKTAARDAVEELHenpwsYDMVLTEVHAPAgIDGFNLLQYAGT-DMDLPVVVFSADDDKRTVLKCVNSGACDYLVKPLRHEELKN 153
                       6666666666666666666669************99********9755.559**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.7E-2124167IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.8E-2924167No hitNo description
SMARTSM004482.3E-925155IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011027.81826159IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.64E-1428158No hitNo description
PfamPF000729.7E-1171153IPR001789Signal transduction response regulator, receiver domain
TIGRFAMsTIGR015571.9E-10182225IPR006447Myb domain, plants
SuperFamilySSF466892.51E-6182225IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-13182225IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAGSCSVASS NKSKLADEEF SPVGMRVLLI DESTTYLKII TKLLLNCGYK GLTVTNFEIT  60
YVWRVDEVTP KTAARDAVEE LHENPWSYDM VLTEVHAPAG IDGFNLLQYA GTDMDLPVVV  120
FSADDDKRTV LKCVNSGACD YLVKPLRHEE LKNIWQHVYR RKLRSGGRRA AAAGNSSKGE  180
IKKRFRWPKE LHERFVSVVL QLGVDKATPN QILPLLNRED LTRDQRFRIA LTKSKALPSC  240
STIPIGETVH GIPLALQAIG TGNNQHLIVP FNRITFVRPR GVEIGQNGVV GGLVTGNNNV  300
VVPTATSIIA RAFGREIVNG ADLFDHGTLI RDSSSTSHDG AQNELGETNL AFELMAKKGS  360
DVEPRIGG*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6AU68
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g32890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g32890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349320.0AC134932.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0092G21, complete sequence.
GenBankAC1324830.0AC132483.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0014C03, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ6AU680.0Q6AU68_ORYSJ; Os05g0395700 protein
STRINGLOC_Os05g32890.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1706467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.11e-35response regulator 10