PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g27980.1
Common NameOs05g0346800, OSNPB_050346800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 201aa    MW: 21105.8 Da    PI: 6.7789
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g27980.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.7e-4461051100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +
  LOC_Os05g27980.1   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPAQQRGDAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQ 98 
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  LOC_Os05g27980.1  99 LAVAQAE 105
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6065106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGGGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPAQQRG  60
DAVSSLVYEA NARMRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQHRDDGAAH  120
QLDAAADHHP LLDQQQQQQM VVDAADAAAS FLVQNGGGGG GPAAQLISGY GSPAAGGGGG  180
HGVVHYAAAQ EHLKRESLWT *
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154633280.0
Expression AtlasA0A0P0WKY8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g27980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g27980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349280.0AC134928.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1164G01, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638859.11e-145PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW32e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0E0HD051e-145A0A0E0HD05_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PL281e-145A0A0E0PL28_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZXQ91e-145A0A0D9ZXQ9_9ORYZ; Uncharacterized protein
TrEMBLA2Y3H81e-145A2Y3H8_ORYSI; Putative uncharacterized protein
TrEMBLQ5W6R01e-145Q5W6R0_ORYSJ; Os05g0346800 protein
TrEMBLA0A0P0WKY81e-145A0A0P0WKY8_ORYSJ; Os05g0346800 protein (Fragment)
STRINGBGIOSGA018244-PA1e-144(Oryza sativa Indica Group)
STRINGBGIOSGA018245-PA1e-144(Oryza sativa Indica Group)
STRINGLOC_Os05g27980.11e-144(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-71LBD family protein