PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g27730.1
Common NameLOC4338474, Os05g0343400, OsJ_18137, OSNPB_050343400, OsWRKY53, P0015F11.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 488aa    MW: 50980.3 Da    PI: 8.0581
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g27730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.8e-33190248260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK+vkgse+prsYY+Ct++gC++kkkvers  d+++++i+Y+g Hnh+k
  LOC_Os05g27730.1 190 EDGYNWRKYGQKQVKGSENPRSYYKCTYNGCSMKKKVERSLADGRITQIVYKGAHNHPK 248
                       8********************************************************85 PP

2WRKY105.82.3e-33351409159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDg++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d+++v++tYeg+Hnh+
  LOC_Os05g27730.1 351 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDTRAVITTYEGKHNHD 409
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.451184249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-29187249IPR003657WRKY domain
SuperFamilySSF1182906.28E-26188249IPR003657WRKY domain
SMARTSM007742.9E-36189248IPR003657WRKY domain
PfamPF031062.6E-25190247IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-36336411IPR003657WRKY domain
SuperFamilySSF1182903.27E-29343411IPR003657WRKY domain
PROSITE profilePS5081138.124346411IPR003657WRKY domain
SMARTSM007743.6E-39351410IPR003657WRKY domain
PfamPF031061.4E-25352409IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MASSTGGLDH GFTFTPPPFI TSFTELLSGG GGDLLGAGGE ERSPRGFSRG GARVGGGVPK  60
FKSAQPPSLP LSPPPVSPSS YFAIPPGLSP TELLDSPVLL SSSHILASPT TGAIPAQRYD  120
WKASADLIAS QQDDSRGDFS FHTNSDAMAA QPASFPSFKE QEQQVVESSK NGAAAASSNK  180
SGGGGNNKLE DGYNWRKYGQ KQVKGSENPR SYYKCTYNGC SMKKKVERSL ADGRITQIVY  240
KGAHNHPKPL STRRNASSCA TAAACADDLA APGAGADQYS AATPENSSVT FGDDEADNAS  300
HRSEGDEPEA KRWKEDADNE GSSGGMGGGA GGKPVREPRL VVQTLSDIDI LDDGFRWRKY  360
GQKVVKGNPN PRSYYKCTTV GCPVRKHVER ASHDTRAVIT TYEGKHNHDV PVGRGGGGGR  420
APAPAPPTSG AIRPSAVAAA QQGPYTLEML PNPAGLYGGY GAGAGGAAFP RTKDERRDDL  480
FVESLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-35189411877Probable WRKY transcription factor 4
1wj2_A4e-35189411877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.117730.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379908130.0
Expression AtlasQ5W6M7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g27730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g27730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1904360.0AB190436.1 Oryza sativa Japonica Group OsWRKY53 mRNA for transcription factor OsWRKY53, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640378.10.0PREDICTED: probable WRKY transcription factor 26 isoform X3
SwissprotQ8S8P51e-109WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLQ5W6M70.0Q5W6M7_ORYSJ; Os05g0343400 protein
STRINGLOC_Os05g27730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP85333448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-95WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Chujo T, et al.
    Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice.
    Biochim. Biophys. Acta, 2007 Jul-Aug. 1769(7-8): p. 497-505
    [PMID:17532485]