PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g11414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 289aa    MW: 32575.7 Da    PI: 9.1827
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g11414.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.41.2e-3051101151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                       krien++nrqvtf+kRr g+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  LOC_Os05g11414.1  51 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101
                       79***********************************************95 PP

2K-box105.28.1e-351192154100
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       s+ + ++e +a+++qqe+akLk++i nLq+++R l+G+++++++++eL+qLe +L+k+l kiR++Knell+++ie++q++e elq++n++L++
  LOC_Os05g11414.1 119 SNASTVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKS 211
                       34444999************************************************************************************* PP

             K-box  97 klee 100
                       k++e
  LOC_Os05g11414.1 212 KVAE 215
                       *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.21243103IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-3943102IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-324565IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-3245116IPR002100Transcription factor, MADS-box
CDDcd002651.68E-4345117No hitNo description
PROSITE patternPS0035004599IPR002100Transcription factor, MADS-box
PfamPF003193.7E-265299IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-326580IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-3280101IPR002100Transcription factor, MADS-box
PfamPF014862.1E-26128213IPR002487Transcription factor, K-box
PROSITE profilePS5129714.732129219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APVASPGSGG SGGSGSVGAE KIGSRGKIEI KRIENTTNRQ  60
VTFCKRRSGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNSVKETIER YKKANSDTSN  120
ASTVAEINAQ HYQQEAAKLK QQITNLQNSN RTLVGDNITT MNHRELKQLE GRLDKGLGKI  180
RARKNELLCA EIEYMQRRET ELQNDNMYLK SKVAESERGL QTVNMMGSAS TSEYVQNMIH  240
YDPRNFLQFN IMHQPQYYPE QEDRKAFMSG KKYSQCNIVR VHSSTNEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-1945130290Myocyte-specific enhancer factor 2A
3kov_B2e-1945130290Myocyte-specific enhancer factor 2A
3kov_I2e-1945130290Myocyte-specific enhancer factor 2A
3kov_J2e-1945130290Myocyte-specific enhancer factor 2A
3p57_A2e-1945130290Myocyte-specific enhancer factor 2A
3p57_B2e-1945130290Myocyte-specific enhancer factor 2A
3p57_C2e-1945130290Myocyte-specific enhancer factor 2A
3p57_D2e-1945130290Myocyte-specific enhancer factor 2A
3p57_I2e-1945130290Myocyte-specific enhancer factor 2A
3p57_J2e-1945130290Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.480400.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2620937640.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g11414.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g11414
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509420.0FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
GenBankAB2321570.0AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.10.0PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P10.0MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0D9ZVI20.0A0A0D9ZVI2_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g11414.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.14e-94MIKC_MADS family protein