PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g11380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 149aa    MW: 16509.4 Da    PI: 4.9721
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g11380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.51.5e-273584251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      +ie++  rqvtf+kR ng+lKKA+ELS LCdaeva+i+fss+g+lyeys+
  LOC_Os05g11380.1 35 SIEDTADRQVTFCKRCNGLLKKAYELSMLCDAEVALIVFSSRGRLYEYSN 84
                      8***********************************************95 PP

2K-box21.78.1e-09101134336
             K-box   3 kssgksleeakaeslqqelakLkkeienLqreqR 36 
                       +s+++ ++e +a+++qqe+akLk+ i  Lq+++R
  LOC_Os05g11380.1 101 TSNTSTVAEINAQHYQQEAAKLKQHITYLQNSNR 134
                       34444499**********************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-242685IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.5252686IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-232848IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-263499IPR002100Transcription factor, MADS-box
PfamPF003191.5E-243682IPR002100Transcription factor, MADS-box
CDDcd002652.39E-3536100No hitNo description
PRINTSPR004041.2E-234863IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-236384IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGS SEGSSIEDTA DRQVTFCKRC NGLLKKAYEL  60
SMLCDAEVAL IVFSSRGRLY EYSNNSVEET IERYKKANSD TSNTSTVAEI NAQHYQQEAA  120
KLKQHITYLQ NSNRFIISLS CLDFFFST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-172794269Myocyte-specific enhancer factor 2B
1tqe_Q9e-172794269Myocyte-specific enhancer factor 2B
1tqe_R9e-172794269Myocyte-specific enhancer factor 2B
1tqe_S9e-172794269Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.851241e-179flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g11380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g11380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509421e-123FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
GenBankAB2321571e-123AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankAK1117231e-123AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638533.14e-79PREDICTED: MADS-box transcription factor 58-like
SwissprotQ2V0P16e-75MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLB8AZ831e-96B8AZ83_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0PIS31e-96A0A0E0PIS3_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZVI02e-96A0A0D9ZVI0_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9ZVH92e-95A0A0D9ZVH9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HAW82e-92A0A0E0HAW8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0HAW72e-92A0A0E0HAW7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0HAW62e-92A0A0E0HAW6_ORYNI; Uncharacterized protein
STRINGLOC_Os05g11380.11e-108(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP4046733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-54MIKC_MADS family protein