PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g10690.1
Common NameLOC4338039, Os05g0195700, OsJ_17441, OSNPB_050195700, P0473H02.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 288aa    MW: 30461.5 Da    PI: 9.5694
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g10690.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-15124168347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++ ++ +  +lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  LOC_Os05g10690.1 124 PWTEEEHQMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHAQKY 168
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.18117173IPR017930Myb domain
SuperFamilySSF466891.51E-18118174IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-18120172IPR006447Myb domain, plants
SMARTSM007171.5E-11121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-12121167IPR009057Homeodomain-like
CDDcd001675.95E-10124169No hitNo description
PfamPF002493.0E-12124168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCSG QRVLDHSISS SNSGSTTAAA ATACGGLRLF GVQLQVGGGS  60
SPLKKCLSME CLASPAYYGA SASPSVSSSS SSLVSIEENT ERVSNGYLSD GLMGRVQERK  120
KGVPWTEEEH QMFLAGLDKL GKGDWRGISR HFVTTRTPTQ VASHAQKYFL RQNSMTQKKR  180
RSSLFDVVEG IKRAAAMPIS GSASELQIPG MSIGVGVVKE EVVLPPCLNL MSNSSSASQH  240
SPSLTLLANP QVQLQMPDLE LKMSTSRLSD QSGPSPSTPF FGTIRVT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.230870.0leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329756120.0
Expression AtlasQ6L4N3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g10690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g10690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0655940.0AK065594.1 Oryza sativa Japonica Group cDNA clone:J013029P13, full insert sequence.
GenBankAK0614270.0AK061427.1 Oryza sativa Japonica Group cDNA clone:006-306-H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637665.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0PIL70.0A0A0E0PIL7_ORYRU; Uncharacterized protein
TrEMBLQ6L4N30.0Q6L4N3_ORYSJ; Os05g0195700 protein
STRINGLOC_Os05g10690.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-45MYB_related family protein