PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g09020.2
Common NameLOC4337998, Os05g0183100, P0683B12.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 128aa    MW: 14169.8 Da    PI: 9.8091
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g09020.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.91.4e-302886159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                      ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh 
  LOC_Os05g09020.2 28 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCNVKKRVERDREDHRYVITTYDGVHNHA 86
                      59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.3E-331688IPR003657WRKY domain
SuperFamilySSF1182906.02E-282088IPR003657WRKY domain
PROSITE profilePS5081131.4222388IPR003657WRKY domain
SMARTSM007742.5E-342887IPR003657WRKY domain
PfamPF031061.1E-232985IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MRYESEEKMR ARVNGRIGFR TRSEVEILDD GFKWRKYGKK AVKNSPNPRN YYRCSTEGCN  60
VKKRVERDRE DHRYVITTYD GVHNHASPAA AAAALQYAAA AGDYYSPPLS SAGSPPAAYS  120
AGGSLLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-271489378Probable WRKY transcription factor 4
2lex_A1e-271489378Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.196211e-133leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166329971e-133
Expression AtlasQ65WY5-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g09020.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g09020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8328020.0CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638018.12e-90PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ53e-40WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A0E0PIC82e-90A0A0E0PIC8_ORYRU; Uncharacterized protein
TrEMBLQ6IEL42e-90Q6IEL4_ORYSI; WRKY transcription factor 67
TrEMBLQ65WY52e-90Q65WY5_ORYSJ; Os05g0183100 protein
STRINGBGIOSGA018676-PA6e-90(Oryza sativa Indica Group)
STRINGLOC_Os05g09020.16e-90(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.19e-40WRKY DNA-binding protein 50