PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g07270.1
Common NameOs05g0165450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 208aa    MW: 21567.6 Da    PI: 8.8075
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g07270.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40271261100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++pyf   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+ae
  LOC_Os05g07270.1  27 PCAACKLLRRRCAQECPFSPYFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAE 119
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++ 
  LOC_Os05g07270.1 120 LAAVRAD 126
                       **99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.22726127IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4027124IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MARRSCSMPA AGAGPGSAAA AVNTITPCAA CKLLRRRCAQ ECPFSPYFSP LEPHKFASVH  60
KVFGASNVSK MLLEVHESQR GDAANSLVYE ANLRLRDPVY GCMGAILTLQ QQVQALEAEL  120
AAVRADIVRH KYRLPSAAAV LPSSHASHLL AAAAAARQLP VAGTMGVVTT ATLPASASSS  180
STTAVYAAAS SSTDYSSITN ENVPYFS*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasC7J2W5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g07270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g07270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1343410.0AC134341.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0027N19, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638927.11e-117PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ9AT611e-67LBD13_ARATH; LOB domain-containing protein 13
TrEMBLC7J2W51e-149C7J2W5_ORYSJ; Os05g0165450 protein
STRINGLOC_Os05g07270.11e-148(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-58LOB domain-containing protein 13