PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g07010.2
Common NameLOC9266268, OsJ_17225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 247aa    MW: 26762.6 Da    PI: 8.9567
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g07010.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.9e-152569147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rW++eE+e+++da  ++G + Wk+I + +  ++t+ q++s+ qk+
  LOC_Os05g07010.2 25 RERWSAEEHERFLDALILFGRD-WKRIEAFVA-TKTAIQIRSHAQKH 69
                      78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-151975IPR009057Homeodomain-like
PROSITE profilePS5129417.2132074IPR017930Myb domain
TIGRFAMsTIGR015572.2E-152472IPR006447Myb domain, plants
SMARTSM007171.8E-102472IPR001005SANT/Myb domain
PfamPF002494.3E-112569IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-72569IPR009057Homeodomain-like
CDDcd001678.96E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAAMAAAAAG TKKKARKPYT ITRPRERWSA EEHERFLDAL ILFGRDWKRI EAFVATKTAI  60
QIRSHAQKHF LKARKFGLAG GLPPPLHPRR ATLLRANAAA ADMMPPPWLP SAGGGSIGCS  120
APPSGVQQSM AGRSPACYST DEASFRPLIH SNDNDCSFIE TPSCIGSGGE SWIGDDAFFM  180
QDETIRLPIS PDDLGFAQVY KFVGDMFGSG ERRPVEAHLR RLQGMDPAIS ETILLVLKNL  240
EANLSA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.707041e-155leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977237361e-155
Expression AtlasB9FHP5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g07010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g07010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126131e-153CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
GenBankAC1241441e-153AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence.
GenBankAP0149611e-153AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638954.10.0PREDICTED: protein REVEILLE 8
TrEMBLA0A0E0PHY30.0A0A0E0PHY3_ORYRU; Uncharacterized protein
TrEMBLB9FHP50.0B9FHP5_ORYSJ; Uncharacterized protein
STRINGBGIOSGA018757-PA1e-180(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.19e-33MYB_related family protein