PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g06340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 226aa    MW: 24618.9 Da    PI: 8.4391
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g06340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.71.8e-192761135
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C+ Cg+t+Tp+WR gp g+++LCnaCG++yrkk++
  LOC_Os05g06340.1 27 CVECGATTTPMWRGGPTGPRSLCNACGIRYRKKRR 61
                      ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.9E-162171IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.732157IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-132364No hitNo description
Gene3DG3DSA:3.30.50.105.5E-152562IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034402752IPR000679Zinc finger, GATA-type
CDDcd002025.22E-122762No hitNo description
PfamPF003203.2E-172761IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGSSDQKVIG IAAAAAAAAE EAGRRCCVEC GATTTPMWRG GPTGPRSLCN ACGIRYRKKR  60
RQELGLDKKQ QQEHHPHHHQ QQQQQYQRQQ QQQQQEDHSD AASSVKDSSS SSSNKSSSLQ  120
VISEIVISRS KSDCEGAMEG NCVPLKRLVQ QVDFLLSSTG ITESCQCVAV SCANQMGLQK  180
AANVLLFLVP IRVLTMENNS CDILHIIRII GRGCGIESKT RIIDR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.78340.0leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976038720.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g06340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g06340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2410160.0AK241016.1 Oryza sativa Japonica Group cDNA, clone: J065054C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639203.12e-39PREDICTED: GATA transcription factor 23
TrEMBLI1PSL41e-116I1PSL4_ORYGL; Uncharacterized protein
STRINGLOC_Os05g06340.11e-165(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP2612444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.11e-19GATA transcription factor 23