PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g06170.1
Common NameOs05g0153600, OSJNBa0059G01.2, OSJNBa0072C16.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 314aa    MW: 35966 Da    PI: 5.1893
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g06170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR139.81.5e-1298144147
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47 
                       +fYn+YAk+ GFsvrk+  +++kr g i  r+fvCskeg r+++  k
  LOC_Os05g06170.1  98 NFYNSYAKRKGFSVRKDIVRREKRVGAIEYRRFVCSKEGIRDPSLVK 144
                       6***************************************9987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.8E-1098142IPR004330FAR1 DNA binding domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGEFRGTGNE DDAKCGTGNE DDAKCGKDCS TDSYMDNSSN TNDDDYAECS LGDHNKSKPN  60
DPSSSHNVFH SVEEDNVALD EYWNIVQMNF QTEDECYNFY NSYAKRKGFS VRKDIVRREK  120
RVGAIEYRRF VCSKEGIRDP SLVKPEDREF ALQEDFEYGV YDDQTNMVEQ IIQLEIRRSS  180
GRMSLNGIKK LNLLRASKQI HATEHTWLII CRQDLALIES LKIVVILYDI NLHCLETLQV  240
KDGELQNLAN NIRARDATIK EIADKLTQTA QAAEAAASAT HTMDEHRRLL CSEIERLRHY  300
KQWKDKCNNP CSR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.831840.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ65XP1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g06170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g06170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0934931e-162AC093493.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0072C16, complete sequence.
GenBankAC0934921e-162AC093492.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0059G01, complete sequence.
GenBankAP0149611e-162AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619261.13e-65PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLQ65XP10.0Q65XP1_ORYSJ; Os05g0153600 protein
STRINGLOC_Os05g06170.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.19e-10FAR1-related sequence 12