PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g04210.1
Common NameOsJ_17012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 311aa    MW: 33960 Da    PI: 5.9504
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g04210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-192976148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd llvd+++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  LOC_Os05g04210.1 29 RGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYL 76
                      89********************************************97 PP

2Myb_DNA-binding51.13.2e-1682125146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os05g04210.1  82 RGNITADEQLLILDLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 125
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1992476IPR017930Myb domain
SuperFamilySSF466894.12E-3127123IPR009057Homeodomain-like
SMARTSM007171.5E-152878IPR001005SANT/Myb domain
PfamPF002496.3E-172976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-233083IPR009057Homeodomain-like
CDDcd001678.38E-123176No hitNo description
PROSITE profilePS5129422.52777131IPR017930Myb domain
SMARTSM007174.2E-1481129IPR001005SANT/Myb domain
PfamPF002491.3E-1482125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2284130IPR009057Homeodomain-like
CDDcd001671.98E-1086125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEMMRMAMSP AMSSATAAAA SEDEGDLRRG PWTVEEDMLL VDYIANHGEG RWNSLARCAG  60
LRRTGKSCRL RWLNYLRPDV RRGNITADEQ LLILDLHSRW GNRWSKIAQY LPGRTDNEIK  120
NYWRTRVQKH AKQLRCDVNS KEFRDVVRHV WMPRLIERIQ ADAAAAGEVA APAPVSAAAT  180
RSMSSPAGAM YLHHQQIPLA AGAMVVAPAV SSEAYHHHGC GGGGDTSCSE PSQAAVTMSP  240
DDASSTLRSS SAAAENDTIH GDVLSGSWSE LLATTTTTIA ATAGLPDFDE LGDFEDNLWS  300
LEDIWLHQQC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252612324120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.763650.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160130240.0
Expression AtlasB9FGW2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g04210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g04210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1182880.0AC118288.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077L08, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK2436590.0AK243659.1 Oryza sativa Japonica Group cDNA, clone: J100089B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638460.10.0PREDICTED: transcription factor MYB108
TrEMBLB9FGW20.0B9FGW2_ORYSJ; Uncharacterized protein
STRINGLOC_Os05g04210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-80myb domain protein 112