PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g03884.1
Common NameHOS9, LOC4337701, Os05g0129700, OSH71, OSJNBa0056I11.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 312aa    MW: 33348.2 Da    PI: 5.0141
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g03884.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092442772255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  LOC_Os05g03884.1 244 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 277
                       59*****************************885 PP

2ELK33.11.2e-11197218122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK++Ll+KYsg+L+ L++EF+
  LOC_Os05g03884.1 197 ELKEMLLKKYSGCLSRLRSEFL 218
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-185397IPR005540KNOX1
PfamPF037901.6E-195594IPR005540KNOX1
SMARTSM012564.0E-27104155IPR005541KNOX2
PfamPF037912.8E-23108154IPR005541KNOX2
SMARTSM011883.6E-6197218IPR005539ELK domain
PROSITE profilePS5121310.423197217IPR005539ELK domain
PfamPF037891.4E-8197218IPR005539ELK domain
PROSITE profilePS5007112.681217280IPR001356Homeobox domain
SuperFamilySSF466898.55E-20219288IPR009057Homeodomain-like
SMARTSM003892.5E-14219284IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-27222282IPR009057Homeodomain-like
CDDcd000863.64E-13229281No hitNo description
PfamPF059205.2E-17237276IPR008422Homeobox KN domain
PROSITE patternPS000270255278IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEDLYSIHPG ISRGGGGGGG GAASEASGVA GGGSSPPHPP PPATTAAAAD LTELMKAQIA  60
GHPSYPSLLS AYIECRKVGA PPEVTTLLEE IGREGRGGGG GATAGGEIGL DPELDEFMET  120
YCRVLERYKE ELTRPFDEAA SFLTGIHTQL ASLCGGAPPP TDNSDEMVGS SEDEPCSGDA  180
DAADFGQEHS SRLADHELKE MLLKKYSGCL SRLRSEFLKK RKKGKLPKDA RSALMDWWNT  240
HYRWPYPTEE DKVRLAAMTG LDPKQINNWF INQRKRHWKP SEDMRFALME GVTGGSSSGT  300
TLYFDTGTIG P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212221LRSEFLKKRK
2218222KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41620.0callus| flower| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379885410.0
Expression AtlasQ7GDL5-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium, and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:10488233}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g03884.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g03884
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288850.0AB028885.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH71, complete cds.
GenBankAK1118780.0AK111878.1 Oryza sativa Japonica Group cDNA clone:J033046I12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637898.10.0PREDICTED: homeobox protein knotted-1-like 10
SwissprotA2Y0070.0KNOSA_ORYSI; Homeobox protein knotted-1-like 10
SwissprotQ7GDL50.0KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBLA0A0D3G2U30.0A0A0D3G2U3_9ORYZ; Uncharacterized protein
TrEMBLB8AXK90.0B8AXK9_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0H8Y20.0A0A0E0H8Y2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PH180.0A0A0E0PH18_ORYRU; Uncharacterized protein
TrEMBLI1PS570.0I1PS57_ORYGL; Uncharacterized protein
STRINGBGIOSGA018883-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g03884.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0020500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-78KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Postma-Haarsma AD, et al.
    Characterization of the KNOX class homeobox genes Oskn2 and Oskn3 identified in a collection of cDNA libraries covering the early stages of rice embryogenesis.
    Plant Mol. Biol., 1999. 39(2): p. 257-71
    [PMID:10080693]
  2. Ito Y,Eiguchi M,Kurata N
    Expression of novel homeobox genes in early embryogenesis in rice.
    Biochim. Biophys. Acta, 1999. 1444(3): p. 445-50
    [PMID:10095070]
  3. Sentoku N, et al.
    Regional expression of the rice KN1-type homeobox gene family during embryo, shoot, and flower development.
    Plant Cell, 1999. 11(9): p. 1651-64
    [PMID:10488233]
  4. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]