PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g03860.1
Common NameLOC4337699, Os05g0129300, OsJ_16993, OSJNBa0056I11.13, OSNPB_050129300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 149aa    MW: 15955 Da    PI: 9.9973
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g03860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.6e-142483463
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                       ++ +r+ +NRe+ArrsR+RK++++eeL  +++ L+aeN +   ++  +  e +k++ e+
  LOC_Os05g03860.1 24 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGEN 83
                      5678999**********************************9999999998888877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-182185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.32386IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-112378No hitNo description
PfamPF001708.6E-102579IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-102577No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MSSPSRRSSS PESNTSGGGG GADERKRKRM LSNRESARRS RARKQQRLEE LIAEAARLQA  60
ENARVEAQIG AYAGELSKVD GENAVLRARH GELAGRLQAL GSVLEILQVA GAPVDIPEIP  120
DDPLLRPWQP PFAAQPIVAT AMADAFQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13744RRSRARKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33730.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ688Q7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g03860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g03860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1305980.0AC130598.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0056I11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK1051380.0AK105138.1 Oryza sativa Japonica Group cDNA clone:001-102-F02, full insert sequence.
GenBankAK1048440.0AK104844.1 Oryza sativa Japonica Group cDNA clone:001-042-G08, full insert sequence.
GenBankAK0651800.0AK065180.1 Oryza sativa Japonica Group cDNA clone:J013002D17, full insert sequence.
GenBankX573250.0X57325.1 Rice lip19 mRNA for basic/leucine zipper protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639544.11e-101PREDICTED: ocs element-binding factor 1
SwissprotP240682e-35OCS1_MAIZE; Ocs element-binding factor 1
TrEMBLA2Y0021e-101A2Y002_ORYSI; Putative uncharacterized protein
TrEMBLQ084181e-101Q08418_ORYSA; Basic/leucine zipper protein
TrEMBLQ688Q71e-101Q688Q7_ORYSJ; BZIP transcription factor
STRINGBGIOSGA019116-PA1e-101(Oryza sativa Indica Group)
STRINGLOC_Os05g03860.11e-101(Oryza sativa Japonica Group)
STRINGLOC_Os05g03865.11e-101(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5511678
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.18e-25basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Aguan K,Sugawara K,Suzuki N,Kusano T
    Low-temperature-dependent expression of a rice gene encoding a protein with a leucine-zipper motif.
    Mol. Gen. Genet., 1993. 240(1): p. 1-8
    [PMID:8341255]