PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g03740.1
Common NameLOC4337690, Os05g0128000, OsJ_16984, OSNPB_050128000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 334aa    MW: 36946.9 Da    PI: 6.1586
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g03740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix636.8e-2057121165
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65 
                       +W++ e+ a +++r ++++++ ++k++k+lWe+ s+++++ gf r+p qCk+kw+nl +r+k ++
  LOC_Os05g03740.1  57 QWSHAETAAFLAIRADLDHSFLSTKRNKALWEAASARLHALGFARTPDQCKSKWKNLVTRFKGTE 121
                       7*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.02E-2156121No hitNo description
PfamPF138377.0E-1557121No hitNo description
PROSITE profilePS500907.06258114IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDPFHHLNSS FSNPYHPLLA SPPHHFAPDP LPPPPPPPPP PLLPADPPSL ERERLPQWSH  60
AETAAFLAIR ADLDHSFLST KRNKALWEAA SARLHALGFA RTPDQCKSKW KNLVTRFKGT  120
EGAAAVAAAG TDQMQGGQGG GAAARGSSSS FPFHDELRRI FDARVERARA LERKKVKGKD  180
PDDDHDGGGD GDEDDEEEAD QQVDEEDDGA SGDTTRAGSK KRRRKAAAAA RRTGSTGGVE  240
GEVEAMLREF MRRQIEMEER WMEAAEAREA ERRAREEEWR TAMVALGEER LALVRRWRER  300
EDAWRARAEE REERRHQLVA ALLAKLGAGD ASA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219224KKRRRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166404130.0
Expression AtlasQ0DL24-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g03740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g03740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1305980.0AC130598.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0056I11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637591.10.0PREDICTED: trihelix transcription factor GT-3b
RefseqXP_015637590.10.0PREDICTED: trihelix transcription factor GT-3b
TrEMBLA0A0E0PH000.0A0A0E0PH00_ORYRU; Uncharacterized protein
TrEMBLQ0DL240.0Q0DL24_ORYSJ; Os05g0128000 protein
STRINGLOC_Os05g03740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1431444
MonocotsOGMP125953134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-26Trihelix family protein