PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g03550.1
Common NameOsJ_16973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 1581aa    MW: 170922 Da    PI: 6.7024
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g03550.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-07727769347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  LOC_Os05g03550.1 727 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 769
                       899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-13710772IPR009057Homeodomain-like
PROSITE profilePS5129314.547723774IPR017884SANT domain
SMARTSM007174.8E-7724772IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-5727771IPR009057Homeodomain-like
PfamPF002499.3E-6727769IPR001005SANT/Myb domain
PROSITE profilePS5129313.728932983IPR017884SANT domain
SMARTSM007176.6E-4933981IPR001005SANT/Myb domain
CDDcd001670.00121937975No hitNo description
SuperFamilySSF466891.4E-8937983IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1581 aa     Download sequence    Send to blast
MAAGTTATPS HRQPPRRRDG YYRQGGGSYD RSYPDESLGY TPSRSDRYWL DDDGGGGGYK  60
GFSRYGGGGG GGSRRDGRDM RGSYRRSPFR GYGSDFSRNH QEHPPPPLRR SPLRSVAVPM  120
SYDPPGDRAD RGDRDHHHRV TPWRPLRRRE SRSDAADAAG AGPVPVGQAA AAAASEKDVS  180
ARSSAVAAPQ VSEEEAPRKK PRLGWGQGLA KYEKQKVQGP AESAEAVAEG SPTATEQKGI  240
THTPAPAPCV SPVAAPSPTP CASPVAAPSP APCVSPVAAP SPAPPCKSPV PEDKSCELTA  300
NTVTESNKNI PGPDVQACNN EVPTKLDQLE GDPIDSLAKV LSELVQHEDS CSGDSKRLSN  360
VSKLLLLKES ISKELEKTEL EIDSLEGELK SVNVEARNRT LKDPPTAVTY AQNPSPSPVK  420
EQGELTPSPK ISMEQDADVK GSELMEIETA QAHNAKAVSS EESVACPGVA LGQVPAAADV  480
IPSDPCGKTG SGIDVDIEQR EENPCQETFN AMKADGSSDL ATRPCSYREV KYNLMDQIIA  540
ANRSEAKKNS QLLFKPVPAD RSNLDLLASS YLSSQMKNDV IIKKKHAILK NRQRFKEQIL  600
TFKFRVLRHL WKEDVRLLSV RKQRSKSHKR TDQSNRSSQS GSQRQRSSNR SRLAVPAGNL  660
STFPITEMSG VARKLFSEFQ LKRCRNYLKM PALIVDEKEK AGAKFVSKNG LVEDPVSVEK  720
ERALINPWIQ EEKEIFMEKL ATFGKDFSKI SSFLQHKTTA DCIEFYYKHH KSDSFREVKK  780
LLDLRQQQQP ANNYLGAVSG KKWNPEANAA SLDMLGVATE VAAQGLEYVN EVKKNSAKSI  840
LRTVCGVDNS TKGSEKDCVG DVSLHERESV AADVLAGICG TLSPEGMGSC ITSSADPGQK  900
IGIISRMEHL LTPEADKNFD DDGTLSDQEC EVDIVDWNDD EKSSFIEAMN RYGKDFARIS  960
SYVKSKSFEQ CKVFFSKARK SLGLDLIHQG AADAGFPTGD ANGGRSGTDG ACIAEMDSAI  1020
CSAQSCPKVE IDACPVSDGE IQGHNPLSDI ASRQPEADKS NMPDVVDINV EEGESKAEKD  1080
CSILVDHKQL REDINQTSCA RIDINCPEST DKLQDIEDVT PVNMHGDDLM ATSVEQVAAA  1140
HVESRSSLHS EGIGIDVSRI EGCSHESTIG KGGKSTPSVC LPAENGVSKE NIIHFSNMDG  1200
ASSISPAFTS NYQQSKLADP IQSKPKPLTP KDLMPVQFSS SLPDPTSICF EGIAAITTPN  1260
FEDHGNRASI ASGAKDVNMF PTFKDQSSNR HDALFSNVDG YMQQRRNNHF GTEVCGLSES  1320
TGISQSDQFT VSKFQNGRPS SLGLSNGNLG VLSTGRREEA REGLFRPCSV KTSAGNEEQQ  1380
KRPGDVKLFG QILSHQSSLQ SSGSSVHGSK SKPPSPKVDK PASSRLLSNP RERLVYSSRP  1440
PIIANLGLEE RAMRSFDHMD GRTIQPEPMV MVAKCQRPSA GVPVYSTKNG ALSVFAEFQQ  1500
PSMPPHTSDH KLLENFADLH KRNGIELLSG FQQPGRLGGA GVLVSGVSDP VAALKAQYGS  1560
GSKMLSSSND VDTWKDIGSR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-16685776494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-16685776494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.104470.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977236600.0
Expression AtlasB9FGL5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g03550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g03550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLB9FGL50.0B9FGL5_ORYSJ; Uncharacterized protein
STRINGLOC_Os05g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.19e-77MYB family protein