PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g02730.1
Common NameLOC107275686, Os05g0118700, OsJ_016162, P0496H07.20, WOX2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 287aa    MW: 29893.7 Da    PI: 8.2328
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g02730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.3e-202685357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      +R+++t+eql  Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  LOC_Os05g02730.1 26 TRWCPTPEQLMMLEEMYRGgLRTPNAAQIQQITAHLstygRIEGKNVFYWFQNHKARDRQ 85
                      8*****************99*************************************996 PP

2Wus_type_Homeobox118.72.6e-382486264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ+++Lee+y+ GlrtPn+++iq+ita+L++yG+ie+kNVfyWFQN+kaR+rqk
   LOC_Os05g02730.1 24 STTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQK 86
                       579***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.752186IPR001356Homeobox domain
SMARTSM003895.2E-52390IPR001356Homeobox domain
SuperFamilySSF466896.42E-112589IPR009057Homeodomain-like
PfamPF000461.3E-172685IPR001356Homeobox domain
CDDcd000866.60E-52686No hitNo description
Gene3DG3DSA:1.10.10.604.7E-72685IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAPAVQQQQS GGGGGSTGAA AVGSTTRWCP TPEQLMMLEE MYRGGLRTPN AAQIQQITAH  60
LSTYGRIEGK NVFYWFQNHK ARDRQKLRRR LCISHHLLSC AHYYHHHLAA AAAVVPPPQL  120
LPPLHPSSSS SSCGGGLIDH ANSLLSPTSA TTPTSAAAAA AAAAYTTSYY YPFTAAAAPP  180
PPRTSPAASP LFHYNQGGGG VVLPAAEAIG RSSSSSDYSL GKLVDNFGVA LEETFPAQPQ  240
QPATTMAMTA VVDTTAVAAA AGGFCRPLKT LDLFPGGLKE EQHDVV*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5W7C3
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g02730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g02730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4902440.0AM490244.1 Oryza sativa mRNA for putative wuschel homeobox protein (wox3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639083.10.0PREDICTED: putative WUSCHEL-related homeobox 2
SwissprotQ5W7C30.0WOX2_ORYSJ; Putative WUSCHEL-related homeobox 2
TrEMBLA0A0E0H8Q40.0A0A0E0H8Q4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PGR80.0A0A0E0PGR8_ORYRU; Uncharacterized protein
TrEMBLA8Y7W50.0A8Y7W5_ORYSA; Putative wuschel homeobox protein
STRINGLOC_Os05g02730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55801121
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-38WOX family protein
Publications ? help Back to Top
  1. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]