PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g02420.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 209aa    MW: 22927.6 Da    PI: 7.545
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g02420.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-163277148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgr T++E+ l+++++ q+G++ W++Iar ++ gRt++++k++w++++
  LOC_Os05g02420.2 32 RGRITADEERLILHLHSQWGSR-WSRIARSLP-GRTDNEIKNFWRTHM 77
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-101238IPR009057Homeodomain-like
SuperFamilySSF466893.08E-211283IPR009057Homeodomain-like
PROSITE profilePS500904.311326IPR017877Myb-like domain
PROSITE profilePS5129422.8942781IPR017930Myb domain
SMARTSM007177.0E-153179IPR001005SANT/Myb domain
PfamPF002496.2E-143276IPR001005SANT/Myb domain
CDDcd001672.51E-113677No hitNo description
Gene3DG3DSA:1.10.10.601.4E-183978IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MDGAGGRPTG LKRTGKSCRL RWVNYLHPGL KRGRITADEE RLILHLHSQW GSRWSRIARS  60
LPGRTDNEIK NFWRTHMRKI AHHAKKKTNS PSPAPTTSSG SLSSSLTTAT TTMATAAALQ  120
ESSSCGGDDE AVDQLVAAAT TPASQLLTMD YTMDQLWNDI AAAEADTSCY DAAAMASPPS  180
PVWEFCTDYS LWRIDDEEYY KKMLDASQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-17137937103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.582600.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379882970.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g02420.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g02420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8295370.0CT829537.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA012K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639553.11e-154PREDICTED: transcription factor MYB48
TrEMBLA0A0E0H8M61e-147A0A0E0H8M6_ORYNI; Uncharacterized protein
STRINGBGIOSGA019054-PA1e-146(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.31e-42myb domain protein 48