PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g02150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 353aa    MW: 36473.6 Da    PI: 8.5766
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g02150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-3799157361
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  LOC_Os05g02150.1  99 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 157
                       56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3982156IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.789102156IPR003851Zinc finger, Dof-type
PfamPF027017.3E-32102156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNNNNN HNQQQQQQHA HGHHQHHQVA AGCGGGGGGG DGNSHELLQQ  60
QSMIPGTLAD GGGGGGAVGP AKPMSMSERA RLARIPLPEP GLKCPRCDST NTKFCYFNNY  120
SLSQPRHFCR ACRRYWTRGG ALRNVPVGGG YRRHAKRAKP KPASAAGSAS AATTTAGSTP  180
AGSTTTTTTS STCATPNAPA LPAMLGGNLS ILPPLLRLAD FDAMSLGSTF SGMAAAAGKP  240
PPVDAAGCYS VGAATGLEQW RLQQMQSFPF FHAMDHQAAM AAPPPAMAMP GMFQLGLDGD  300
GHGSGGGEDG GELHHAMPSS KREGYPRGMY GDHHLAGGYT SYSSATTGNH LL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.558780.0panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329941420.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g02150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g02150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1089330.0AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.10.0PREDICTED: dof zinc finger protein DOF3.6
TrEMBLA0A0E0H8J70.0A0A0E0H8J7_ORYNI; Uncharacterized protein
TrEMBLB8AXC70.0B8AXC7_ORYSI; Putative uncharacterized protein
STRINGLOC_Os05g02150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-45OBF-binding protein 3