PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g58680.1
Common NameLOC107278593, Os04g0683400, OsHAP5G, OsJ_16673, OSJNBa0032F06.24, OSNPB_040683400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YC
Protein Properties Length: 126aa    MW: 13221 Da    PI: 9.1825
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g58680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC83.81.9e-26541163799
             NF-YC  37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                       +mis eaPv++skacelfi elt r+w  + e krrt++k d+aaav++td fdflvd+v  d
  LOC_Os04g58680.1  54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116
                       8**********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.1E-2418109IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.5E-3119101IPR009072Histone-fold
PfamPF008082.6E-1252100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MRQARPYSAM FAGGVSARTG PHALPLARIK KIMKRSAGDS SVVDGGGGGG GGARMISGEA  60
PVVFSKACEL FIAELTRRAW AATLEGKRRT VHKEDVAAAV QNTDLFDFLV DVVTADLGDD  120
HTDYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C3e-252211340117HapE
4g92_C3e-252211340117HapE
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XPV7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g58680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g58680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAB2880470.0AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds.
GenBankAL6066410.0AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635297.13e-87PREDICTED: nuclear transcription factor Y subunit C-2-like
SwissprotQ8LCG73e-31NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
SwissprotQ9ZVL36e-31NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLQ7XPV74e-87Q7XPV7_ORYSJ; HAP5 subunit of HAP complex
STRINGLOC_Os04g58680.11e-86(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31517117
MonocotsOGMP116583339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.26e-31nuclear factor Y, subunit C2
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]