PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g58190.3
Common NameOs04g0678400, OSJNBa0064G10.24, OSNPB_040678400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 207aa    MW: 21646.9 Da    PI: 8.1155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g58190.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.49.8e-3645100257
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 
                       k+++l+cprC stntkfCyynnys+sqPr+fC+aCrryWt+GG+lr+vPvGg++r+
  LOC_Os04g58190.3  45 KQQQLECPRCRSTNTKFCYYNNYSTSQPRHFCRACRRYWTHGGTLRDVPVGGASRR 100
                       7899*************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.5E-3247100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.73649103IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-214993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAPAVASSPS LVLSAAAATA SNKRPADSDA SPPHQGDRTG QQEKKQQQLE CPRCRSTNTK  60
FCYYNNYSTS QPRHFCRACR RYWTHGGTLR DVPVGGASRR GGGGKRRRVS ADADPSSASP  120
PPPTTSTTDA YADLPAGFPF LSDGAFLPQF GLAGVAPAAF SWASAVPDLY NCGIAPWDDG  180
TAVTGAAWDN FADIAGLDLS WPPPGN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104108KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.916280.0callus| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329927330.0
Expression AtlasQ7FAN8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g58190.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g58190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1075240.0AK107524.1 Oryza sativa Japonica Group cDNA clone:002-129-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448779.19e-70hypothetical protein SORBIDRAFT_06g033010
TrEMBLA0A0D3G1R51e-149A0A0D3G1R5_9ORYZ; Uncharacterized protein
TrEMBLA2XZ001e-149A2XZ00_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0H7I91e-149A0A0E0H7I9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PFS61e-149A0A0E0PFS6_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZSH71e-149A0A0D9ZSH7_9ORYZ; Uncharacterized protein
TrEMBLQ259D31e-149Q259D3_ORYSA; H0402C08.16 protein
TrEMBLQ7FAN81e-149Q7FAN8_ORYSJ;
STRINGBGIOSGA014085-PA1e-148(Oryza sativa Indica Group)
STRINGLOC_Os04g58190.11e-148(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.12e-28Dof family protein