PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g58020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 448aa    MW: 46300.2 Da    PI: 8.6085
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g58020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-12274318347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  LOC_Os04g58020.1 274 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 318
                       6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.851157215IPR017884SANT domain
SMARTSM007172.6E-5158213IPR001005SANT/Myb domain
SuperFamilySSF466897.48E-9161217IPR009057Homeodomain-like
CDDcd001671.70E-5162211No hitNo description
PROSITE profilePS5129416.605267323IPR017930Myb domain
SuperFamilySSF466893.81E-16269324IPR009057Homeodomain-like
SMARTSM007179.3E-11271321IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.9E-17271321IPR006447Myb domain, plants
CDDcd001678.05E-10274319No hitNo description
PfamPF002495.9E-11274318IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-10274317IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MSASASAVCL LPPRGGSLAR PDTALPPASQ PATVAVNQNI PRLASPRLAV TSITLLPRRG  60
RRCAVDLLLL HLHRLLLFLS LFSEETPNLF LPRKPAAFLK RIKSPSLIRR CNPSPQNLAA  120
PRAVLGFELM AVEEASSSSG GGRGGGGGGG GEEGLSGCGG GWTREQEKAF ENALATVGDD  180
EEEGDGLWEK LAEAVEGKTA DEVRRHYELL VEDVDGIEAG RVPLLVYAGD GGVEEGSAGG  240
GKKGGGGGGG GGGGGHGEKG SAKSSEQERR KGIAWTEDEH RLFLLGLEKY GKGDWRSISR  300
NFVISRTPTQ VASHAQKYFI RLNSMNRERR RSSIHDITSV NNGDTSAAQG PITGQPNGPS  360
ANPGKSSKQS LQPANAPPGV DAYGTTIGQP VGGPLVSAVG TPVTLPVPAA PHIAYGMHAP  420
VPGAVVPGAP VNMPPMPYPM PPPTSHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-13157232678RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239247GGKKGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1007730.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329913750.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g58020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g58020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0686230.0AK068623.1 Oryza sativa Japonica Group cDNA clone:J013153N23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636999.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLA0A0E0PFQ70.0A0A0E0PFQ7_ORYRU; Uncharacterized protein
STRINGLOC_Os04g58020.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-78MYB family protein