PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g56990.1
Common NameLOC4337318, Os04g0665600, OSNPB_040665600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 425aa    MW: 46308.2 Da    PI: 7.0698
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g56990.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32241295155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  LOC_Os04g56990.1 241 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 295
                       68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.662238298IPR017930Myb domain
SuperFamilySSF466898.78E-18239295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-30240296IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-24241296IPR006447Myb domain, plants
PfamPF002497.8E-9245294IPR001005SANT/Myb domain
PfamPF143792.2E-22326372IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MLQDIMNTKK IKLHDCHFGS PLCDPSPAPH LLSSAAAAGL SFHPGLVSSA AQHQQHGAGG  60
WLHEEYYAPR SSPPSSLLAQ TCVGSNATAF YAAENLPQFD FPALGTAAAA AAKAPFRSSE  120
SELYRPVDPL LLRADHSVRT YYVRPQKRDS GERTPLPPPS QQQHQDRIHG LFAGAPTTRL  180
LSGEPKIHSF PPQVAAKPIL PAMDAPSLQN QMENQLTRNC IGAATPVTPT GNLAGSGAPS  240
KTRIRWTQDL HERFVDCVNQ LGGADKATPK GILKLMNSDG LTIYHIKSHL QKYRIAKYMP  300
ASSEGKQLEK RATGNDMQNL DPKTGMQITE ALRVQLDVQR RLHEQLEIQR NLQLRIEEQG  360
KRLQKMFEDQ LKASRSVMEP QELDDVVAFA AGDGDDDAFD DVDVQLLAVA GSGYDDAGFQ  420
SKIS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.75120.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0J995
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g56990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g56990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019510.0AK101951.1 Oryza sativa Japonica Group cDNA clone:J033075I07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636272.10.0PREDICTED: uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636271.10.0PREDICTED: uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636270.10.0PREDICTED: uncharacterized protein LOC4337318 isoform X1
RefseqXP_015636269.10.0PREDICTED: uncharacterized protein LOC4337318 isoform X1
TrEMBLA0A0D3G1C30.0A0A0D3G1C3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PFB70.0A0A0E0PFB7_ORYRU; Uncharacterized protein
TrEMBLI1PQM70.0I1PQM7_ORYGL; Uncharacterized protein
TrEMBLA0A0D9ZS270.0A0A0D9ZS27_9ORYZ; Uncharacterized protein
TrEMBLQ0J9950.0Q0J995_ORYSJ; Os04g0665600 protein
STRINGLOC_Os04g56990.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0249600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.16e-67G2-like family protein