PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g56850.2
Common NameARF11, ARF5, MP, Os04g0664400, OSJNBa0084K01.22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 921aa    MW: 101292 Da    PI: 6.412
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g56850.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.94e-23143244199
                       EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                       f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F   ++
  LOC_Os04g56850.2 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFI--RD 232
                       89*********************999*****9555555.49************************************************..45 PP

                       SEE..EEEEE-S CS
                B3  88 sefelvvkvfrk 99 
                       ++ +l+++v+r+
  LOC_Os04g56850.2 233 EKSQLLLGVRRA 244
                       677789999997 PP

2Auxin_resp117.61.1e-38269351183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       aahaas++s F+++YnPr+s+s Fv++v++++ka++++ svGmRf m+fete+ss+rr++Gtvvg+sd+dp+rWpnSkWr+L+
  LOC_Os04g56850.2 269 AAHAASSGSSFTIYYNPRTSPSPFVIPVARYNKATYMQPSVGMRFAMMFETEESSKRRYTGTVVGISDYDPMRWPNSKWRNLQ 351
                       79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.27E-45133272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-40136257IPR015300DNA-binding pseudobarrel domain
CDDcd100172.50E-20142243No hitNo description
PROSITE profilePS5086312.689143245IPR003340B3 DNA binding domain
PfamPF023621.1E-20143244IPR003340B3 DNA binding domain
SMARTSM010191.3E-22143245IPR003340B3 DNA binding domain
PfamPF065074.6E-34269351IPR010525Auxin response factor
SuperFamilySSF542771.24E-5849920No hitNo description
PROSITE profilePS5174521.699852920IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 921 aa     Download sequence    Send to blast
MASSQEKAKT GVLRNAAALL DEMQLMGETQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTRKIPNSR IPNYPNLPSQ LLCQVHNITL HADKDTDEVY AQMTLQPVNS  120
ETDVFPIPTL GAYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NMWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI RDEKSQLLLG  240
VRRATRQQTM LSSSVLSTDS MHIGVLAAAA HAASSGSSFT IYYNPRTSPS PFVIPVARYN  300
KATYMQPSVG MRFAMMFETE ESSKRRYTGT VVGISDYDPM RWPNSKWRNL QVEWDEHGYG  360
ERPERVSIWD IETPENTLVF PSSTLNSKRQ CLPGYGVSVP GMEIGSANMS SFPRAQGNPY  420
GSLQHIPAVG SELAIMLLNQ SGQTLGSPLS FHQSSYSSII QNVKQNYIPP LTVSTSACLT  480
KQESLPSDDA QHQFHMANMQ NGDLEGSEVQ PVIDSISESK LNATSRDPRN TDSYTSRSTS  540
EQNSKGEPRG KTRRSKKGLP HKTVSEKSDL SSAPSWICDN QQVGLESKLV GCDEQVNCGN  600
IEDSSGALTQ GNFVGQPHGH QVEQKGVLSP PKVESSKSPD GGKSVNSFPN QGCFSQFIDG  660
LDWMTQPSYY QDSNVIQPAG VSENIFSSSA DIPPSMIADT METFQASCLS DCLPNSIQEF  720
ISSPDLNSLT FLSPDMQNLE VQLQHDGSNL PSTSNSFVQM SFSEESASQS ANLSGLHMES  780
THRSINTTSC SQPMSTGGFD AGMYSKLPRL KESQILSLPE IHTNSMGTSA CSMDATEYSL  840
DRSAKPMKPP VRTYTKVQKQ GSVGRSIDVT GFRNYHELRS AIACMFGLQG KLEHPGSSEW  900
KLVYVDYEND VLLVGDDPWE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.013745390Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.485130.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329886610.0
Expression AtlasQ8S983-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g56850.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g56850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712920.0AB071292.1 Oryza sativa OsMP mRNA for Arabidopsis Monopteros-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634367.10.0PREDICTED: auxin response factor 11-like
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLI1PQL70.0I1PQL7_ORYGL; Auxin response factor
STRINGLOC_Os04g56850.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0248600.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Sato Y, et al.
    Auxin response factor family in rice.
    Genes Genet. Syst., 2001. 76(6): p. 373-80
    [PMID:11922106]
  2. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]