PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g55590.1
Common NameHB3, LOC4337218, Os04g0649400, OsJ_015698, OSJNBa0010D21.16, OSJNBb0059K02.2, WOX4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 237aa    MW: 25783.5 Da    PI: 9.7874
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g55590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1991150357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       +R+++++eq+++Le l++   r+p+  ++e+++++l    +++ ++V++WFqN++a+e++
  LOC_Os04g55590.1  91 TRWNPSAEQIKVLEMLYRGgMRTPNSVQIERITEELgkygRIEGKNVFYWFQNHKARERQ 150
                       8*****************99**************************************97 PP

2Wus_type_Homeobox115.91.9e-3790152365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+P++eQik+Le+ly+ G+rtPn+ +i+rit+eL +yG+ie+kNVfyWFQN+kaRerqkq
   LOC_Os04g55590.1  90 TTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNHKARERQKQ 152
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.92886151IPR001356Homeobox domain
SMARTSM003892.3E-688155IPR001356Homeobox domain
SuperFamilySSF466893.21E-1290156IPR009057Homeodomain-like
CDDcd000862.72E-591152No hitNo description
Gene3DG3DSA:1.10.10.601.4E-791150IPR009057Homeodomain-like
PfamPF000464.7E-1791150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MRLHHLHVAY LDHKASSSSS SPAPPSISPS SIPGSAAFPA FSFKCLRPLA PKISLPEPRK  60
MIAPPDFVVP RARNASKLLN YTVQVPAAGT TRWNPSAEQI KVLEMLYRGG MRTPNSVQIE  120
RITEELGKYG RIEGKNVFYW FQNHKARERQ KQKRAALLTL STLDPSLLPA TANETKEAPE  180
KKEKDVEDGL ASCKRRCKAW GDGAGDGDAV VATEAAGGCT DEVTLELFPL HPQGKA*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XTV3
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g55590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g55590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8361590.0JF836159.1 Oryza sativa Japonica Group WUSCHEL-like homeobox protein (WOX4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635367.11e-176PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ25AM21e-178WOX4_ORYSI; WUSCHEL-related homeobox 4
SwissprotQ7XTV31e-178WOX4_ORYSJ; WUSCHEL-related homeobox 4
TrEMBLF6MIV61e-176F6MIV6_ORYSJ; WUSCHEL-like homeobox protein
TrEMBLA0A0D3G0Z21e-176A0A0D3G0Z2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H6P11e-176A0A0E0H6P1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PEX61e-176A0A0E0PEX6_ORYRU; Uncharacterized protein
TrEMBLI1PQB11e-176I1PQB1_ORYGL; Uncharacterized protein
STRINGLOC_Os04g55590.11e-175(Oryza sativa Japonica Group)
STRINGBGIOSGA014217-PA1e-175(Oryza sativa Indica Group)
STRINGORGLA04G0238000.11e-175(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP71671117
MonocotsOGMP126923035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.19e-38WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]
  2. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]