PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g54474.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 371aa    MW: 41971.5 Da    PI: 6.0974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g54474.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.7e-1276116242
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                       +++k+ rr+++NReAAr+sR+RKka+i++Le+   +L +  
  LOC_Os04g54474.2  76 PPDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQLE 116
                       5799***************************8544443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1175139IPR004827Basic-leucine zipper domain
PfamPF001707.8E-977117IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.93377121IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.29E-779125No hitNo description
Gene3DG3DSA:1.20.5.1705.9E-881129No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
PfamPF141443.6E-26167243IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MTSASTQFAA PVRMGAYDRP PPVGMWSHEQ FKVDNGQATS ASTIMEAEMK FENRLEEIPQ  60
VVLEEGRNVD QEASKPPDKV LRRLAQNREA ARKSRLRKKA YIQQLETSRL KLAQLEQELQ  120
RARQQAVYAN GSLREPNLGF TGPIDPGALG FEIKYSHWVD EQNRNTGELR NALLQGQTTD  180
QDLELKLLVE AGLDNYNRLF EMKEEAANSD VFYIMSGMWK TPTERFFLWI GGFRPSEVLK  240
NLRPQLEPLT DKQVVEVGGL QQTSMQVEDA LSQGMDKLKQ TIADSLTAAD PFDSPEAYMV  300
HMANAVEQLR SLVQFVTQAD HLRQQTLQEM HRILTTRQAA RGLLALGDYF QRFRALSSLW  360
AARPRDSGIS *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.271780.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329769240.0
Expression AtlasB7EMK6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g54474.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g54474
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737150.0AK073715.1 Oryza sativa Japonica Group cDNA clone:J033059P06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636715.10.0PREDICTED: transcription factor TGA4 isoform X2
RefseqXP_015636714.10.0PREDICTED: transcription factor TGA4 isoform X2
RefseqXP_015636713.10.0PREDICTED: transcription factor TGA4 isoform X2
RefseqXP_015636712.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636711.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636710.10.0PREDICTED: transcription factor TGA4 isoform X1
SwissprotQ391621e-131TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A0D3G0490.0A0A0D3G049_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9ZRD80.0A0A0D9ZRD8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PEM40.0A0A0E0PEM4_ORYRU; Uncharacterized protein
TrEMBLB7EMK60.0B7EMK6_ORYSJ; cDNA clone:J033059P06, full insert sequence
TrEMBLI1PPQ20.0I1PPQ2_ORYGL; Uncharacterized protein
STRINGORGLA04G0217100.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-122TGACG motif-binding factor 4