PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g53540.4
Common NameGL2-2, LOC4337074, Os04g0627000, OSJNBb0060E08.16, ROC2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 782aa    MW: 85337.4 Da    PI: 5.6189
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g53540.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20102158157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  LOC_Os04g53540.4 102 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 158
                       688999************************************************995 PP

2START203.96.5e-642925171206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT- CS
             START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetl 76 
                       ela +a++elv++a+++ep+W+  +         e + ++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ +
  LOC_Os04g53540.4 292 ELAVAAMEELVRMAQLDEPLWSVAPpldataaamETLSEEEYARMFPRGLGpkqygLRSEASRDSAVVIMTHANLVEILMDANQyaaVFSNIV 384
                       57899********************9**999999899999999999887779*******************************6666666666 PP

                       SEEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
             START  77 akaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                        +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+s
  LOC_Os04g53540.4 385 SRAITLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYS 473
                       6*****************************************************************98....7******************** PP

                       EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       kvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  LOC_Os04g53540.4 474 KVTWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 517
                       ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-2282157IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2089159IPR009057Homeodomain-like
PROSITE profilePS5007117.0799159IPR001356Homeobox domain
SMARTSM003892.3E-20100163IPR001356Homeobox domain
CDDcd000861.34E-19101160No hitNo description
PfamPF000466.3E-18102157IPR001356Homeobox domain
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PROSITE profilePS5084841.609283520IPR002913START domain
SuperFamilySSF559614.6E-35285519No hitNo description
CDDcd088756.86E-120287516No hitNo description
SMARTSM002341.0E-58292517IPR002913START domain
PfamPF018525.8E-54293517IPR002913START domain
Gene3DG3DSA:3.30.530.207.3E-6358513IPR023393START-like domain
SuperFamilySSF559612.34E-23538771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MERREIFQVA DLAHILRGKP VDHLQQPNLL DNHQFQQAFQ HQQQQHHLLD QIPATTAESG  60
DNMIRSRASD PLGGDEFESK SGSENVDGVS VDDQDPNQRP RKKRYHRHTQ HQIQEMEAFF  120
KECPHPDDKQ RKELSRELGL EPLQVKFWFQ NKRTQMKNQH ERHENSQLRS DNEKLRAENM  180
RYKEALSSAS CPNCGGPAAL GEMSFDEHHL RIENARLREE IDRISAIAAK YVGKPMVPFP  240
VLSNPMAAAA SRAPLDLPVA PYGVPGDMFG GGGAGELLRG VQSEVDKPMI VELAVAAMEE  300
LVRMAQLDEP LWSVAPPLDA TAAAMETLSE EEYARMFPRG LGPKQYGLRS EASRDSAVVI  360
MTHANLVEIL MDANQYAAVF SNIVSRAITL EVLSTGVAGN YNGALQVMSV EFQVPSPLVP  420
TRESYFVRYC KQNADGTWAV VDVSLDSLRP SPVLKCRRRP SGCLIQEMPN GYSKVTWVEH  480
VEVDDRSVHN IYKLLVNSGL AFGARRWVGT LDRQCERLAS VMASNIPTSD IGVITSSEGR  540
KSMLKLAERM VVSFCGGVTA SVAHQWTTLS GSGAEDVRVM TRKSVDDPGR PPGIVLNAAT  600
SFWLPVPPKR VFDFLRDESS RSEWDILSNG GIVQEMAHIA NGRDQGNCVS LLRVNSSNSN  660
QSNMLILQES CTDASGSYVI YAPVDVVAMN VVLNGGDPDY VALLPSGFAI LPDGPAHDGG  720
DGDGGVGVGS GGSLLTVAFQ ILVDSVPTAK LSLGSVATVN SLIACTVERI KAAVSGESNP  780
Q*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.124320.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO313390960.0
Expression AtlasQ0J9X2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g53540.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g53540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636340.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLQ00RL20.0Q00RL2_ORYSA;
STRINGLOC_Os04g53540.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2