PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g53540.3
Common NameGL2-2, LOC4337074, Os04g0627000, OSJNBb0060E08.16, ROC2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 785aa    MW: 85259.4 Da    PI: 5.7266
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g53540.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20105161157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  LOC_Os04g53540.3 105 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 161
                       688999************************************************995 PP

2START203.96.6e-642955201206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT- CS
             START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetl 76 
                       ela +a++elv++a+++ep+W+  +         e + ++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ +
  LOC_Os04g53540.3 295 ELAVAAMEELVRMAQLDEPLWSVAPpldataaamETLSEEEYARMFPRGLGpkqygLRSEASRDSAVVIMTHANLVEILMDANQyaaVFSNIV 387
                       57899********************9**999999899999999999887779*******************************6666666666 PP

                       SEEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
             START  77 akaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                        +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+s
  LOC_Os04g53540.3 388 SRAITLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYS 476
                       6*****************************************************************98....7******************** PP

                       EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       kvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  LOC_Os04g53540.3 477 KVTWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 520
                       ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-2285160IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2092162IPR009057Homeodomain-like
PROSITE profilePS5007117.07102162IPR001356Homeobox domain
SMARTSM003892.3E-20103166IPR001356Homeobox domain
CDDcd000861.35E-19104163No hitNo description
PfamPF000466.4E-18105160IPR001356Homeobox domain
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PROSITE profilePS5084841.609286523IPR002913START domain
SuperFamilySSF559614.67E-35288522No hitNo description
CDDcd088751.51E-119290519No hitNo description
SMARTSM002341.0E-58295520IPR002913START domain
PfamPF018525.8E-54296520IPR002913START domain
Gene3DG3DSA:3.30.530.207.3E-6361516IPR023393START-like domain
SuperFamilySSF559612.4E-23541774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MMIPARHMPS MIGRNGAAYG SSSALSLSQP NLLDNHQFQQ AFQHQQQQHH LLDQIPATTA  60
ESGDNMIRSR ASDPLGGDEF ESKSGSENVD GVSVDDQDPN QRPRKKRYHR HTQHQIQEME  120
AFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK NQHERHENSQ LRSDNEKLRA  180
ENMRYKEALS SASCPNCGGP AALGEMSFDE HHLRIENARL REEIDRISAI AAKYVGKPMV  240
PFPVLSNPMA AAASRAPLDL PVAPYGVPGD MFGGGGAGEL LRGVQSEVDK PMIVELAVAA  300
MEELVRMAQL DEPLWSVAPP LDATAAAMET LSEEEYARMF PRGLGPKQYG LRSEASRDSA  360
VVIMTHANLV EILMDANQYA AVFSNIVSRA ITLEVLSTGV AGNYNGALQV MSVEFQVPSP  420
LVPTRESYFV RYCKQNADGT WAVVDVSLDS LRPSPVLKCR RRPSGCLIQE MPNGYSKVTW  480
VEHVEVDDRS VHNIYKLLVN SGLAFGARRW VGTLDRQCER LASVMASNIP TSDIGVITSS  540
EGRKSMLKLA ERMVVSFCGG VTASVAHQWT TLSGSGAEDV RVMTRKSVDD PGRPPGIVLN  600
AATSFWLPVP PKRVFDFLRD ESSRSEWDIL SNGGIVQEMA HIANGRDQGN CVSLLRVNSS  660
NSNQSNMLIL QESCTDASGS YVIYAPVDVV AMNVVLNGGD PDYVALLPSG FAILPDGPAH  720
DGGDGDGGVG VGSGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIACTV ERIKAAVSGE  780
SNPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.124320.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO313390960.0
Expression AtlasQ0J9X2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g53540.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g53540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636339.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
RefseqXP_015636338.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLB8AUT50.0B8AUT5_ORYSI; Putative uncharacterized protein
STRINGLOC_Os04g53540.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2