Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g53540.1
Common NameGL2-2, LOC4337074, Os04g0627000, OSJNBb0060E08.16, ROC2
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 785aa    MW: 85259.4 Da    PI: 5.7266
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g53540.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
                       688999************************************************995 PP

             START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetl 76 
                       ela +a++elv++a+++ep+W+  +         e + ++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ +
                       57899********************9**999999899999999999887779*******************************6666666666 PP

             START  77 akaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                        +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+s
                       6*****************************************************************98....7******************** PP

             START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       kvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
                       ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.07102162IPR001356Homeobox domain
SMARTSM003892.3E-20103166IPR001356Homeobox domain
CDDcd000861.35E-19104163No hitNo description
PfamPF000466.4E-18105160IPR001356Homeobox domain
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PROSITE profilePS5084841.609286523IPR002913START domain
SuperFamilySSF559614.67E-35288522No hitNo description
CDDcd088751.51E-119290519No hitNo description
SMARTSM002341.0E-58295520IPR002913START domain
PfamPF018525.8E-54296520IPR002913START domain
Gene3DG3DSA:3.30.530.207.3E-6361516IPR023393START-like domain
SuperFamilySSF559612.4E-23541774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.124320.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasQ0J9X2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636339.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
RefseqXP_015636338.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X1
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLB8AUT50.0B8AUT5_ORYSI; Putative uncharacterized protein
STRINGLOC_Os04g53540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2